DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc4 and CG10862

DIOPT Version :10

Sequence 1:NP_524010.2 Gene:Ubc4 / 39133 FlyBaseID:FBgn0015321 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_647823.1 Gene:CG10862 / 38437 FlyBaseID:FBgn0035455 Length:354 Species:Drosophila melanogaster


Alignment Length:150 Identity:59/150 - (39%)
Similarity:88/150 - (58%) Gaps:4/150 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 MAVSRIKREFKEVMRSEEIVQCSIKIELVNDSWTELRGEIAGPPDTPYEGGKFVLEIKVPETYPF 68
            :.::|::||..| ..:::...|  |.|:|.|:.......|.||.:|.||||:|.:||..|..|||
  Fly   208 LTITRLRREISE-FSTDQTEGC--KAEMVGDNLFHWVATIPGPSETVYEGGRFRVEIVFPRNYPF 269

  Fly    69 NPPKVRFITRIWHPNISSVTGAICLDILKDNWAAAMTLRTVLLSLQALLAAAEPDDPQDAVVAYQ 133
            .||.:.|:|:.:|.|| :::|.||||||...|:.|:::..||:|:.:|||...|.||.:..||..
  Fly   270 YPPYLAFLTKTYHCNI-ALSGRICLDILGSKWSPALSVSKVLISIMSLLADPNPHDPMEVSVADV 333

  Fly   134 FKDKYDLFLLTAKHWTNAYA 153
            ||....|....|:.||..||
  Fly   334 FKGNRALHDKNAREWTKKYA 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc4NP_524010.2 UBCc_UBE2K 6..151 CDD:467420 57/144 (40%)
UBA_II_E2_UBCD4 163..198 CDD:270574
CG10862NP_647823.1 UBCc_UEV 212..352 CDD:483950 57/143 (40%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.