DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc4 and CG10862

DIOPT Version :9

Sequence 1:NP_001287013.1 Gene:Ubc4 / 39133 FlyBaseID:FBgn0015321 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_647823.1 Gene:CG10862 / 38437 FlyBaseID:FBgn0035455 Length:354 Species:Drosophila melanogaster


Alignment Length:150 Identity:59/150 - (39%)
Similarity:88/150 - (58%) Gaps:4/150 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 MAVSRIKREFKEVMRSEEIVQCSIKIELVNDSWTELRGEIAGPPDTPYEGGKFVLEIKVPETYPF 68
            :.::|::||..| ..:::...|  |.|:|.|:.......|.||.:|.||||:|.:||..|..|||
  Fly   208 LTITRLRREISE-FSTDQTEGC--KAEMVGDNLFHWVATIPGPSETVYEGGRFRVEIVFPRNYPF 269

  Fly    69 NPPKVRFITRIWHPNISSVTGAICLDILKDNWAAAMTLRTVLLSLQALLAAAEPDDPQDAVVAYQ 133
            .||.:.|:|:.:|.|| :::|.||||||...|:.|:::..||:|:.:|||...|.||.:..||..
  Fly   270 YPPYLAFLTKTYHCNI-ALSGRICLDILGSKWSPALSVSKVLISIMSLLADPNPHDPMEVSVADV 333

  Fly   134 FKDKYDLFLLTAKHWTNAYA 153
            ||....|....|:.||..||
  Fly   334 FKGNRALHDKNAREWTKKYA 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc4NP_001287013.1 COG5078 1..153 CDD:227410 57/148 (39%)
UQ_con 8..149 CDD:278603 55/140 (39%)
UBA_II_E2_UBCD4 163..198 CDD:270574
CG10862NP_647823.1 COG5078 207..354 CDD:227410 58/149 (39%)
UQ_con 212..349 CDD:278603 55/140 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24068
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.