DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc4 and CG16894

DIOPT Version :9

Sequence 1:NP_001287013.1 Gene:Ubc4 / 39133 FlyBaseID:FBgn0015321 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_611455.1 Gene:CG16894 / 37280 FlyBaseID:FBgn0034483 Length:266 Species:Drosophila melanogaster


Alignment Length:138 Identity:33/138 - (23%)
Similarity:55/138 - (39%) Gaps:20/138 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 YEGGKFVLEIKVPETYP--FNPPKVRFITRIWHPNISSVTGAICLDILKDNWAA-AMTLRTVLLS 112
            |.|..|...|.:||.:|  .:.|.|.|.|.:.||:|......:.|....:.|.. ...:..||..
  Fly    57 YAGSVFRFSILLPENFPADISLPTVVFSTEVLHPHICPQNKTLDLAHFLNEWRKDEHHIWHVLRY 121

  Fly   113 LQALLAAAEPDDPQDAVVAYQFKDKYDLFLLTAKHWTNAYAGGPHTFPDCDSKIQRLRDMGIDEH 177
            :||:.|     ||:.::...| ....||.::......||.           :.:.:.|...|...
  Fly   122 IQAIFA-----DPEGSICTGQ-SSSGDLVIMDEVRNMNAL-----------NMLAKSRPEYIKRV 169

  Fly   178 EARAVLSK 185
            :.:|:||:
  Fly   170 QEQAILSR 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc4NP_001287013.1 COG5078 1..153 CDD:227410 28/104 (27%)
UQ_con 8..149 CDD:278603 26/100 (26%)
UBA_II_E2_UBCD4 163..198 CDD:270574 5/23 (22%)
CG16894NP_611455.1 COG5078 20..176 CDD:227410 31/135 (23%)
UBCc 23..173 CDD:294101 30/132 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438050
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.