DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc4 and Ubc10

DIOPT Version :10

Sequence 1:NP_524010.2 Gene:Ubc4 / 39133 FlyBaseID:FBgn0015321 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_477414.1 Gene:Ubc10 / 37035 FlyBaseID:FBgn0026316 Length:154 Species:Drosophila melanogaster


Alignment Length:157 Identity:50/157 - (31%)
Similarity:79/157 - (50%) Gaps:19/157 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 AVSRIKREFKEVMRSEEIVQCSIK----IELVNDS---WTELRGEIAGPPDTPYEGGKFVLEIKV 62
            |..|:::|..::..:      ::|    |:..:|:   ||.|    ..|.:.||..|.|.:||..
  Fly     3 APRRLRKELSDLQGN------ALKSFRDIKADDDNLLRWTGL----IVPDNPPYNKGAFRIEINF 57

  Fly    63 PETYPFNPPKVRFITRIWHPNISSVTGAICLDILK-DNWAAAMTLRTVLLSLQALLAAAEPDDPQ 126
            |..|||.|||:.|.|||:||||.. .|.:||.|:. :||..|.....|:.:|..|:...||:.|.
  Fly    58 PAEYPFKPPKINFKTRIYHPNIDE-KGQVCLPIISTENWKPATRTDQVVQALVDLINDPEPEHPL 121

  Fly   127 DAVVAYQFKDKYDLFLLTAKHWTNAYA 153
            .|.:|.:|......|:..|:.:|..::
  Fly   122 RAELAEEFLKDRKKFVKNAEDYTKKHS 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc4NP_524010.2 UBCc_UBE2K 6..151 CDD:467420 49/152 (32%)
UBA_II_E2_UBCD4 163..198 CDD:270574
Ubc10NP_477414.1 UBCc_UBE2L3 3..149 CDD:467421 50/157 (32%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.