DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc4 and Ube2t

DIOPT Version :9

Sequence 1:NP_001287013.1 Gene:Ubc4 / 39133 FlyBaseID:FBgn0015321 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_001101814.2 Gene:Ube2t / 360847 RGDID:1310816 Length:204 Species:Rattus norvegicus


Alignment Length:158 Identity:65/158 - (41%)
Similarity:88/158 - (55%) Gaps:22/158 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 SRIKREFKEV-MRSEEIVQCSIKIELVNDSWTE------LRGEIAGPPDTPYEGGKFVLEIKVPE 64
            ||:|:|...: :.....|.|          |.|      ||.:|.|..:||||.|.|.||:.|||
  Rat     5 SRLKKELHMLAIEPPPGVTC----------WQEKDKMDNLRAQILGGANTPYEKGIFTLEVIVPE 59

  Fly    65 TYPFNPPKVRFITRIWHPNISSVTGAICLDIL----KDNWAAAMTLRTVLLSLQALLAAAEPDDP 125
            .|||.||::||:|.|:||||.| :|.||||||    |..|..::.:.|||.|:|.|:|...||||
  Rat    60 RYPFEPPQIRFLTPIYHPNIDS-SGRICLDILKLPPKGAWRPSLNIATVLTSIQLLMAEPNPDDP 123

  Fly   126 QDAVVAYQFKDKYDLFLLTAKHWTNAYA 153
            ..|.::.:||.....|:..|:.||..:|
  Rat   124 LMADISSEFKYNKIAFVKKARQWTETHA 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc4NP_001287013.1 COG5078 1..153 CDD:227410 64/156 (41%)
UQ_con 8..149 CDD:278603 61/151 (40%)
UBA_II_E2_UBCD4 163..198 CDD:270574
Ube2tNP_001101814.2 UBCc 5..147 CDD:238117 62/152 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.