DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc4 and Kua

DIOPT Version :9

Sequence 1:NP_001287013.1 Gene:Ubc4 / 39133 FlyBaseID:FBgn0015321 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_001188856.1 Gene:Kua / 35300 FlyBaseID:FBgn0032850 Length:310 Species:Drosophila melanogaster


Alignment Length:169 Identity:36/169 - (21%)
Similarity:57/169 - (33%) Gaps:38/169 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 DSWTELRGEIAGPPDTPYEGGKFVLEIKVPETYPFNPPKVRFITRIWHPNISSVTGAICLDILKD 98
            |:|        |..|.|..|..|:        .||         |..|.:.:|:|....::...|
  Fly   139 DTW--------GSVDIPMIGKNFL--------RPF---------REHHLDPTSITRHDFIETNGD 178

  Fly    99 NWAAAMTLRTVLLSLQALLAAAEPDDPQD--AVVAYQFKDKYDLFLLTAKH-WTNAYAGGPH--- 157
            |:...:   .:|..|........|.:.|.  ..:||.|.....:.:....| |::.|.|.|.   
  Fly   179 NFMVGI---PILGYLAHYFYIRTPSEIQQHFGWIAYVFLCSIFVAMTNQIHKWSHTYWGLPRWVL 240

  Fly   158 TFPDCDSKIQRL--RDMGIDEHEARAVLSKE--NWNLEK 192
            ....|...:.|.  |...:..||....::..  ||.||:
  Fly   241 LLQSCHIILPRKHHRIHHVAPHETYFCITTGWLNWPLER 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc4NP_001287013.1 COG5078 1..153 CDD:227410 24/121 (20%)
UQ_con 8..149 CDD:278603 23/117 (20%)
UBA_II_E2_UBCD4 163..198 CDD:270574 8/34 (24%)
KuaNP_001188856.1 TMEM189_B_dmain 124..301 CDD:287490 36/169 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438047
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.