DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc4 and CG3473

DIOPT Version :10

Sequence 1:NP_524010.2 Gene:Ubc4 / 39133 FlyBaseID:FBgn0015321 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_609715.1 Gene:CG3473 / 34849 FlyBaseID:FBgn0028913 Length:151 Species:Drosophila melanogaster


Alignment Length:110 Identity:57/110 - (51%)
Similarity:75/110 - (68%) Gaps:6/110 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 IAGPPDTPYEGGKFVLEIKVPETYPFNPPKVRFITRIWHPNISSVTGAICLDILKDNWAAAMTLR 107
            :.||.|:|:|||.|.||:.:||.||...|||||:|:|:||||..| |.||||||||.|:.|:.:|
  Fly    39 VTGPKDSPFEGGNFKLELFLPEDYPMKAPKVRFLTKIFHPNIDRV-GRICLDILKDKWSPALQIR 102

  Fly   108 TVLLSLQALLAAAEPDDP--QDAVVAYQFKDKYDLFL---LTAKH 147
            |||||:||||:|..||||  .|....::..::..:.|   .|.||
  Fly   103 TVLLSIQALLSAPNPDDPLANDVAELWKVNERRAIQLARECTLKH 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc4NP_524010.2 UBCc_UBE2K 6..151 CDD:467420 57/110 (52%)
UBA_II_E2_UBCD4 163..198 CDD:270574
CG3473NP_609715.1 UBCc_UBE2N 4..147 CDD:467433 55/108 (51%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.