DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc4 and Ubc2

DIOPT Version :9

Sequence 1:NP_001287013.1 Gene:Ubc4 / 39133 FlyBaseID:FBgn0015321 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_001260362.1 Gene:Ubc2 / 34487 FlyBaseID:FBgn0015320 Length:232 Species:Drosophila melanogaster


Alignment Length:152 Identity:64/152 - (42%)
Similarity:87/152 - (57%) Gaps:10/152 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 AVSRIKREFKEVMRSEEIVQCSIKIELVNDSWTELRGEIAGPPDTPYEGGKFVLEIKVPETYPFN 69
            :..||::|..|: ..:....||...:  .|:..|....|.|||.:.||||.|.|:|.....|||.
  Fly    87 SAKRIQKELAEI-TLDPPPNCSAGPK--GDNLYEWVSTILGPPGSVYEGGVFFLDIHFSPEYPFK 148

  Fly    70 PPKVRFITRIWHPNISSVTGAICLDILKDNWAAAMTLRTVLLSLQALLAAAEPDDPQDAVVAYQF 134
            ||||.|.|||:|.||:| .|.||||||||||:.|:|:..||||:.:||....|.||....:|.|:
  Fly   149 PPKVTFRTRIYHCNINS-QGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQY 212

  Fly   135 ---KDKYDLFLLTAKHWTNAYA 153
               ::::|..   |:.||..||
  Fly   213 LQNREEHDRI---ARLWTKRYA 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc4NP_001287013.1 COG5078 1..153 CDD:227410 62/150 (41%)
UQ_con 8..149 CDD:278603 60/143 (42%)
UBA_II_E2_UBCD4 163..198 CDD:270574
Ubc2NP_001260362.1 COG5078 86..231 CDD:227410 62/150 (41%)
UQ_con 90..227 CDD:278603 60/143 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24068
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.