DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc4 and CG4502

DIOPT Version :9

Sequence 1:NP_001287013.1 Gene:Ubc4 / 39133 FlyBaseID:FBgn0015321 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_609103.1 Gene:CG4502 / 34002 FlyBaseID:FBgn0031896 Length:306 Species:Drosophila melanogaster


Alignment Length:122 Identity:37/122 - (30%)
Similarity:61/122 - (50%) Gaps:19/122 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 RIKREFKEVMRSEEIVQCSIKIELVNDSWTE--LRGEIAGPPDTPY-----EGG--KFVLEIKVP 63
            |:.:|::|:.|.:........:||||||..|  :|..:. .||:|.     |.|  ..:|.:..|
  Fly   142 RLMKEYREMERLQAKNDAVFTVELVNDSLFEWHVRLHVI-DPDSPLARDMAEMGVPAILLHLSFP 205

  Fly    64 ETYPFNPPKVRFITRIWHPNISS----VTGAICLDILKD-NWAAAMTLRTVLLSLQA 115
            :.:||.||.:|.:    .|:|..    ..||||:::|.. .||:|.|:..|::...|
  Fly   206 DNFPFAPPFMRVV----EPHIEKGYVMEGGAICMELLTPRGWASAYTVEAVIMQFAA 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc4NP_001287013.1 COG5078 1..153 CDD:227410 37/122 (30%)
UQ_con 8..149 CDD:278603 37/122 (30%)
UBA_II_E2_UBCD4 163..198 CDD:270574
CG4502NP_609103.1 UBCc 140..>258 CDD:238117 36/120 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24068
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.