DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc4 and morgue

DIOPT Version :10

Sequence 1:NP_524010.2 Gene:Ubc4 / 39133 FlyBaseID:FBgn0015321 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_608833.1 Gene:morgue / 33648 FlyBaseID:FBgn0027609 Length:491 Species:Drosophila melanogaster


Alignment Length:164 Identity:61/164 - (37%)
Similarity:84/164 - (51%) Gaps:32/164 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 REFKEVMR---------------SEEIVQCSIKIELVNDSWTELRGEIAGPPDTPYEGGKFVLEI 60
            ||...|||               ||.|  .:|.::..|:.|   :..|.|||.:|||||||.|.|
  Fly   331 REPGNVMRNNFLRGEANLLNSYESEGI--SAIPLDRQNNYW---QATILGPPGSPYEGGKFFLFI 390

  Fly    61 KVPETYPFNPPKVRFITRIWHPNISSVTGAICLDILKD-NWAAAMTLRTVLLSLQALLAAAEPDD 124
            ..||.||..||.|||:|:|.|||:|. .|.:.:||.:. ||:.|:.:..||||:|:||.     |
  Fly   391 YFPERYPMTPPTVRFLTKILHPNVSR-HGDVGIDIFQQHNWSLALNVAKVLLSVQSLLT-----D 449

  Fly   125 PQDAV-----VAYQFKDKYDLFLLTAKHWTNAYA 153
            |...|     :.|.::.:.:.|....:.||..||
  Fly   450 PYTEVCMEPELGYIYEHERERFEQLVRAWTWKYA 483

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc4NP_524010.2 UBCc_UBE2K 6..151 CDD:467420 59/160 (37%)
UBA_II_E2_UBCD4 163..198 CDD:270574
morgueNP_608833.1 PLN03029 <104..170 CDD:215544
F-box_SF 234..265 CDD:438852
UEV_Morgue-like 337..483 CDD:467436 56/156 (36%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.