DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc4 and CG40045

DIOPT Version :9

Sequence 1:NP_001287013.1 Gene:Ubc4 / 39133 FlyBaseID:FBgn0015321 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_001036640.1 Gene:CG40045 / 3355079 FlyBaseID:FBgn0058045 Length:168 Species:Drosophila melanogaster


Alignment Length:150 Identity:50/150 - (33%)
Similarity:68/150 - (45%) Gaps:33/150 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 ND--SWTELRGEIAGPPDTPYEGGKFVLEIKVPETYPFNPPKVRFITRIWHPNISSVTGAICLDI 95
            ||  .|..|   |.|||||.||||.|...:..|:.||..||:::|:|.||||||.. .|.:|:.|
  Fly    33 NDIFRWEVL---IIGPPDTLYEGGFFKAHLYFPKEYPLRPPRMKFVTEIWHPNIEK-NGDVCISI 93

  Fly    96 L-------------KDNWAAAMTLRTVLLSLQALLAAAEPDDPQDAVVAYQFKDKYDLFLLTAKH 147
            |             .:.|....|:.|:|:|:.::|  |:|:|...|.|.            .||.
  Fly    94 LHEPGDDKWGYEKASERWLPVHTVETILISVISML--ADPNDESPANVD------------AAKE 144

  Fly   148 WTNAYAGGPHTFPDCDSKIQ 167
            |..:|.........|..|.|
  Fly   145 WRESYTDFKRKVARCV
RKSQ 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc4NP_001287013.1 COG5078 1..153 CDD:227410 46/134 (34%)
UQ_con 8..149 CDD:278603 45/130 (35%)
UBA_II_E2_UBCD4 163..198 CDD:270574 1/4 (25%)
CG40045NP_001036640.1 UQ_con 10..160 CDD:395127 47/144 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438044
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.