DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc4 and ben

DIOPT Version :9

Sequence 1:NP_001287013.1 Gene:Ubc4 / 39133 FlyBaseID:FBgn0015321 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_001162752.1 Gene:ben / 32358 FlyBaseID:FBgn0000173 Length:151 Species:Drosophila melanogaster


Alignment Length:111 Identity:58/111 - (52%)
Similarity:77/111 - (69%) Gaps:1/111 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 IAGPPDTPYEGGKFVLEIKVPETYPFNPPKVRFITRIWHPNISSVTGAICLDILKDNWAAAMTLR 107
            :.||.|:|:|||.|.||:.:||.||.:.|||||||:|:||||..: |.||||:|||.|:.|:.:|
  Fly    39 VTGPNDSPFEGGVFKLELFLPEDYPMSAPKVRFITKIYHPNIDRL-GRICLDVLKDKWSPALQIR 102

  Fly   108 TVLLSLQALLAAAEPDDPQDAVVAYQFKDKYDLFLLTAKHWTNAYA 153
            |:|||:||||:|..||||....||..:|......:..|:.||..||
  Fly   103 TILLSIQALLSAPNPDDPLANDVAELWKVNEAEAIRNAREWTQKYA 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc4NP_001287013.1 COG5078 1..153 CDD:227410 56/109 (51%)
UQ_con 8..149 CDD:278603 54/105 (51%)
UBA_II_E2_UBCD4 163..198 CDD:270574
benNP_001162752.1 UBCc 3..149 CDD:412187 58/111 (52%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438045
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24068
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.