DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc4 and ube2d3

DIOPT Version :9

Sequence 1:NP_001287013.1 Gene:Ubc4 / 39133 FlyBaseID:FBgn0015321 Length:199 Species:Drosophila melanogaster
Sequence 2:XP_005156599.1 Gene:ube2d3 / 321832 ZFINID:ZDB-GENE-030131-551 Length:148 Species:Danio rerio


Alignment Length:150 Identity:66/150 - (44%)
Similarity:89/150 - (59%) Gaps:4/150 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 MAVSRIKREFKEVMRSEEIVQCSIKIELVNDSWTELRGEIAGPPDTPYEGGKFVLEIKVPETYPF 68
            ||:.||::|..::.| :...|||  ...|.|.....:..|.||.::||:||.|.|.|..|..|||
Zfish     1 MALKRIQKELTDLAR-DPPAQCS--AGPVGDDVFHWQATIMGPNESPYQGGVFFLTIHFPTDYPF 62

  Fly    69 NPPKVRFITRIWHPNISSVTGAICLDILKDNWAAAMTLRTVLLSLQALLAAAEPDDPQDAVVAYQ 133
            .||||.|.|||:||||:| .|:||||||:..|:.|:|:..||||:.:||....||||....:|..
Zfish    63 KPPKVAFTTRIYHPNINS-NGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARI 126

  Fly   134 FKDKYDLFLLTAKHWTNAYA 153
            :|...:.:...||.||..||
Zfish   127 YKTDTEKYNRMAKEWTEKYA 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc4NP_001287013.1 COG5078 1..153 CDD:227410 64/148 (43%)
UQ_con 8..149 CDD:278603 60/140 (43%)
UBA_II_E2_UBCD4 163..198 CDD:270574
ube2d3XP_005156599.1 UBCc 1..146 CDD:412187 64/148 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.