DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc4 and ube2e3

DIOPT Version :9

Sequence 1:NP_001287013.1 Gene:Ubc4 / 39133 FlyBaseID:FBgn0015321 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_957215.2 Gene:ube2e3 / 321689 ZFINID:ZDB-GENE-030131-408 Length:209 Species:Danio rerio


Alignment Length:152 Identity:65/152 - (42%)
Similarity:87/152 - (57%) Gaps:10/152 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 AVSRIKREFKEVMRSEEIVQCSIKIELVNDSWTELRGEIAGPPDTPYEGGKFVLEIKVPETYPFN 69
            :..||::|..|: ..:....||...:  .|:..|.|..|.|||.:.||||.|.|:|.....|||.
Zfish    64 SAKRIQKELAEI-TLDPPPNCSAGPK--GDNIYEWRSTILGPPGSVYEGGVFFLDITFSSDYPFK 125

  Fly    70 PPKVRFITRIWHPNISSVTGAICLDILKDNWAAAMTLRTVLLSLQALLAAAEPDDPQDAVVAYQF 134
            ||||.|.|||:|.||:| .|.||||||||||:.|:|:..||||:.:||....|.||....:|.|:
Zfish   126 PPKVTFRTRIYHCNINS-QGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQY 189

  Fly   135 ---KDKYDLFLLTAKHWTNAYA 153
               :.::|..   |:.||..||
Zfish   190 LTNRAEHDRI---ARQWTKRYA 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc4NP_001287013.1 COG5078 1..153 CDD:227410 63/150 (42%)
UQ_con 8..149 CDD:278603 61/143 (43%)
UBA_II_E2_UBCD4 163..198 CDD:270574
ube2e3NP_957215.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.