DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc4 and ube2e3

DIOPT Version :10

Sequence 1:NP_524010.2 Gene:Ubc4 / 39133 FlyBaseID:FBgn0015321 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_957215.2 Gene:ube2e3 / 321689 ZFINID:ZDB-GENE-030131-408 Length:209 Species:Danio rerio


Alignment Length:152 Identity:65/152 - (42%)
Similarity:87/152 - (57%) Gaps:10/152 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 AVSRIKREFKEVMRSEEIVQCSIKIELVNDSWTELRGEIAGPPDTPYEGGKFVLEIKVPETYPFN 69
            :..||::|..|: ..:....||...:  .|:..|.|..|.|||.:.||||.|.|:|.....|||.
Zfish    64 SAKRIQKELAEI-TLDPPPNCSAGPK--GDNIYEWRSTILGPPGSVYEGGVFFLDITFSSDYPFK 125

  Fly    70 PPKVRFITRIWHPNISSVTGAICLDILKDNWAAAMTLRTVLLSLQALLAAAEPDDPQDAVVAYQF 134
            ||||.|.|||:|.||:| .|.||||||||||:.|:|:..||||:.:||....|.||....:|.|:
Zfish   126 PPKVTFRTRIYHCNINS-QGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQY 189

  Fly   135 ---KDKYDLFLLTAKHWTNAYA 153
               :.::|..   |:.||..||
Zfish   190 LTNRAEHDRI---ARQWTKRYA 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc4NP_524010.2 UBCc_UBE2K 6..151 CDD:467420 63/147 (43%)
UBA_II_E2_UBCD4 163..198 CDD:270574
ube2e3NP_957215.2 UBCc_UBE2E 66..206 CDD:467413 63/146 (43%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.