DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc4 and ubc1

DIOPT Version :9

Sequence 1:NP_001287013.1 Gene:Ubc4 / 39133 FlyBaseID:FBgn0015321 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_596239.1 Gene:ubc1 / 2540277 PomBaseID:SPBC2D10.20 Length:217 Species:Schizosaccharomyces pombe


Alignment Length:195 Identity:81/195 - (41%)
Similarity:117/195 - (60%) Gaps:12/195 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 MAVSRIKREFKEVMRSEEIVQCSIKIELVNDSWTELRGEIAGPPDTPYEGGKFVLEIKVPETYPF 68
            |:.:|.:|..||:...::..|..|::..:||..:.|:|...||..||||||.||::|::|..|||
pombe     1 MSDNRSRRIAKELADVQQDKQAGIQVWTINDDISHLKGMFRGPEGTPYEGGYFVVDIEIPIDYPF 65

  Fly    69 NPPKVRFITRIWHPNISSVTGAICLDILKDNWAAAMTLRTVLLSLQALLAAAEPDDPQDAVVAYQ 133
            .|||:.|.|:|:|||:||.|||||||||||.|:...|:::.|:|||:||...||.:||||.||..
pombe    66 RPPKMNFDTKIYHPNVSSQTGAICLDILKDQWSPVYTMKSALISLQSLLCTPEPSNPQDAQVAQV 130

  Fly   134 FKDKYDLFLLTAKHWTNAYAGGPHTFPDCDSK-----------IQRLRDMGIDEHEARAVLSKEN 187
            :...|..|:.||:.||::||..| ...|.|::           |..|:..|........||.:|:
pombe   131 YLQNYQQFVRTAREWTSSYAAAP-AGVDLDAENTEFGGIDPNIITNLQQFGFSTELIVRVLQREH 194

  Fly   188  187
            pombe   195  194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc4NP_001287013.1 COG5078 1..153 CDD:227410 70/148 (47%)
UQ_con 8..149 CDD:278603 67/140 (48%)
UBA_II_E2_UBCD4 163..198 CDD:270574 7/36 (19%)
ubc1NP_596239.1 COG5078 1..150 CDD:227410 70/148 (47%)
UBCc 6..146 CDD:238117 66/139 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 141 1.000 Domainoid score I1211
eggNOG 1 0.900 - - E2759_KOG0418
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H3903
Inparanoid 1 1.050 158 1.000 Inparanoid score I1259
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003491
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_103192
Panther 1 1.100 - - LDO PTHR24068
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2383
TreeFam 1 0.960 - -
1110.820

Return to query results.
Submit another query.