DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc4 and Ube2e3

DIOPT Version :9

Sequence 1:NP_001287013.1 Gene:Ubc4 / 39133 FlyBaseID:FBgn0015321 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_001343324.1 Gene:Ube2e3 / 22193 MGIID:107412 Length:207 Species:Mus musculus


Alignment Length:152 Identity:65/152 - (42%)
Similarity:87/152 - (57%) Gaps:10/152 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 AVSRIKREFKEVMRSEEIVQCSIKIELVNDSWTELRGEIAGPPDTPYEGGKFVLEIKVPETYPFN 69
            :..||::|..|: ..:....||...:  .|:..|.|..|.|||.:.||||.|.|:|.....|||.
Mouse    62 SAKRIQKELAEI-TLDPPPNCSAGPK--GDNIYEWRSTILGPPGSVYEGGVFFLDITFSSDYPFK 123

  Fly    70 PPKVRFITRIWHPNISSVTGAICLDILKDNWAAAMTLRTVLLSLQALLAAAEPDDPQDAVVAYQF 134
            ||||.|.|||:|.||:| .|.||||||||||:.|:|:..||||:.:||....|.||....:|.|:
Mouse   124 PPKVTFRTRIYHCNINS-QGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQY 187

  Fly   135 ---KDKYDLFLLTAKHWTNAYA 153
               :.::|..   |:.||..||
Mouse   188 LTNRAEHDRI---ARQWTKRYA 206

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
Ubc4NP_001287013.1 COG5078 1..153 CDD:227410 63/150 (42%)
UQ_con 8..149 CDD:278603 61/143 (43%)
UBA_II_E2_UBCD4 163..198 CDD:270574