DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc4 and Ube2d1

DIOPT Version :10

Sequence 1:NP_524010.2 Gene:Ubc4 / 39133 FlyBaseID:FBgn0015321 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_001408209.1 Gene:Ube2d1 / 216080 MGIID:2384911 Length:186 Species:Mus musculus


Alignment Length:122 Identity:54/122 - (44%)
Similarity:74/122 - (60%) Gaps:1/122 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 VNDSWTELRGEIAGPPDTPYEGGKFVLEIKVPETYPFNPPKVRFITRIWHPNISSVTGAICLDIL 96
            |.|.....:..|.||||:.|:||.|.|.:..|..|||.|||:.|.|:|:||||:| .|:||||||
Mouse    65 VGDDLFHWQATIMGPPDSAYQGGVFFLTVHFPTDYPFKPPKIAFTTKIYHPNINS-NGSICLDIL 128

  Fly    97 KDNWAAAMTLRTVLLSLQALLAAAEPDDPQDAVVAYQFKDKYDLFLLTAKHWTNAYA 153
            :..|:.|:|:..||||:.:||....||||....:|..:|...:.:...|:.||..||
Mouse   129 RSQWSPALTVSKVLLSICSLLCDPNPDDPLVPDIAQIYKSDKEKYNRHAREWTQKYA 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc4NP_524010.2 UBCc_UBE2K 6..151 CDD:467420 52/118 (44%)
UBA_II_E2_UBCD4 163..198 CDD:270574
Ube2d1NP_001408209.1 UBCc_UBE2D 44..184 CDD:467412 52/119 (44%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.