DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc4 and uev-2

DIOPT Version :9

Sequence 1:NP_001287013.1 Gene:Ubc4 / 39133 FlyBaseID:FBgn0015321 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_498198.1 Gene:uev-2 / 186377 WormBaseID:WBGene00006731 Length:230 Species:Caenorhabditis elegans


Alignment Length:164 Identity:45/164 - (27%)
Similarity:82/164 - (50%) Gaps:19/164 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 DSWTELRGEIAGPPDTPYEGGKFVLEIKVPETYPFNPPKVRFITRIWHPNISSVTGAICLDIL-K 97
            |.|......:.||..:|:|||::.:.:.. ..:|..||...|.|.:.|||: .:.|:|.|.:| :
 Worm    66 DIWCSWICTVPGPRGSPWEGGEYEVSVNF-HKWPIIPPICEFKTPLHHPNV-DLRGSIYLKMLEQ 128

  Fly    98 DNWAAAMTLRTVLLSLQALLAAAEPDDPQ----DAVVAYQ-FKDKYDLFLLTAKHWTNAYAGGPH 157
            ::|::..:|:.:|..:..|||.  ||..|    :|.:.|: .::.|:     ||  ..|||...:
 Worm   129 EHWSSETSLKKLLREISNLLAT--PDLTQAANIEAWMEYENQRENYE-----AK--ARAYAWTVN 184

  Fly   158 TFPDCDSKIQRLRDMGIDEHEARAVLSKENWNLE 191
              |:....::...:.||....|:|.|:.:|..:|
 Worm   185 --PNAVGYMEVSENSGIQRETAKAKLAVQNGAME 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc4NP_001287013.1 COG5078 1..153 CDD:227410 35/124 (28%)
UQ_con 8..149 CDD:278603 34/120 (28%)
UBA_II_E2_UBCD4 163..198 CDD:270574 7/29 (24%)
uev-2NP_498198.1 UQ_con 40..180 CDD:365926 35/124 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24068
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.