DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc4 and ubc-24

DIOPT Version :10

Sequence 1:NP_524010.2 Gene:Ubc4 / 39133 FlyBaseID:FBgn0015321 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_495769.2 Gene:ubc-24 / 186057 WormBaseID:WBGene00006719 Length:160 Species:Caenorhabditis elegans


Alignment Length:153 Identity:43/153 - (28%)
Similarity:74/153 - (48%) Gaps:18/153 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VSRIKREFKEVMRSE-EIVQCSIKIELVNDSWTELRGEIAGPPDTPYEGGKFVLEIKVPETYPFN 69
            :|||::|..::.::: ..::...|||...|.:   :.:|.| ....|:...|.|.:.|...|||.
 Worm    15 LSRIRKEIADLAKNKRRFIKDFRKIEKCKDIF---QFKIIG-DGVLYKNMIFTLTLDVNVEYPFK 75

  Fly    70 PPKVRFITRIWHPNISSVTGAICLD-ILKDNWAAAMTLRTVLLSLQALLAAAEPDDPQDAVVAYQ 133
            ||.::|...::|||:..||..:|.. :|::||....|:..|||:|..||...:...|.:...|:.
 Worm    76 PPYLKFCHNVYHPNVDPVTCELCSPMLLQENWKPETTMEDVLLNLIVLLNEPDLSRPVNIDAAHD 140

  Fly   134 F--------KDKYDLFLLTAKHW 148
            :        |...:|    ||.|
 Worm   141 YIHNKVEFVKKSTEL----AKKW 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc4NP_524010.2 UBCc_UBE2K 6..151 CDD:467420 43/153 (28%)
UBA_II_E2_UBCD4 163..198 CDD:270574
ubc-24NP_495769.2 UBCc 17..160 CDD:214562 42/151 (28%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.