DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc4 and UBE2E3

DIOPT Version :10

Sequence 1:NP_524010.2 Gene:Ubc4 / 39133 FlyBaseID:FBgn0015321 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_006348.1 Gene:UBE2E3 / 10477 HGNCID:12479 Length:207 Species:Homo sapiens


Alignment Length:152 Identity:65/152 - (42%)
Similarity:87/152 - (57%) Gaps:10/152 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 AVSRIKREFKEVMRSEEIVQCSIKIELVNDSWTELRGEIAGPPDTPYEGGKFVLEIKVPETYPFN 69
            :..||::|..|: ..:....||...:  .|:..|.|..|.|||.:.||||.|.|:|.....|||.
Human    62 SAKRIQKELAEI-TLDPPPNCSAGPK--GDNIYEWRSTILGPPGSVYEGGVFFLDITFSSDYPFK 123

  Fly    70 PPKVRFITRIWHPNISSVTGAICLDILKDNWAAAMTLRTVLLSLQALLAAAEPDDPQDAVVAYQF 134
            ||||.|.|||:|.||:| .|.||||||||||:.|:|:..||||:.:||....|.||....:|.|:
Human   124 PPKVTFRTRIYHCNINS-QGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQY 187

  Fly   135 ---KDKYDLFLLTAKHWTNAYA 153
               :.::|..   |:.||..||
Human   188 LTNRAEHDRI---ARQWTKRYA 206

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
Ubc4NP_524010.2 UBCc_UBE2K 6..151 CDD:467420 63/147 (43%)
UBA_II_E2_UBCD4 163..198 CDD:270574