DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prps and PDA1

DIOPT Version :9

Sequence 1:NP_729528.2 Gene:Prps / 39132 FlyBaseID:FBgn0036030 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_011105.4 Gene:PDA1 / 856925 SGDID:S000000980 Length:420 Species:Saccharomyces cerevisiae


Alignment Length:115 Identity:24/115 - (20%)
Similarity:48/115 - (41%) Gaps:22/115 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 GKVVTKKFSNLETCVEIGESVRGEDVYIVQSGSGEIND--NLMEL--LIMINACKI------ASA 129
            |.....::.|.:.|   ..::.|:..    |..|::.:  |:.:|  |.::..|:.      .:|
Yeast   196 GLAFAHQYKNEDAC---SFTLYGDGA----SNQGQVFESFNMAKLWNLPVVFCCENNKYGMGTAA 253

  Fly   130 SRVTAVIPCFPYARQDKKDKLAGSEDNA--ESKKLAKKNYDWKFRSRAPI 177
            ||.:|:...|...:.....|:.|.:..|  ::.|.||   ||....:.|:
Yeast   254 SRSSAMTEYFKRGQYIPGLKVNGMDILAVYQASKFAK---DWCLSGKGPL 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PrpsNP_729528.2 PrsA 48..383 CDD:223538 24/115 (21%)
PDA1NP_011105.4 TPP_enzymes 50..394 CDD:412991 24/115 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0462
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.