DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prps and PRS3

DIOPT Version :9

Sequence 1:NP_729528.2 Gene:Prps / 39132 FlyBaseID:FBgn0036030 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_172540.1 Gene:PRS3 / 837613 AraportID:AT1G10700 Length:411 Species:Arabidopsis thaliana


Alignment Length:322 Identity:80/322 - (24%)
Similarity:135/322 - (41%) Gaps:65/322 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 SANPIRARSLIRDNLEKQAGCLNLIHSRMPNIKVFSGTSHPDLAQRIVDRLG-IDLGKVVTKKFS 83
            |::||...:...::..|.:..:.|.||          ....|||:|||.:.. |:|..:..|||.
plant    80 SSSPITMAAATSESGSKSSKRVCLFHS----------DETRDLAERIVAKSDCIELRSINWKKFD 134

  Fly    84 ----NLETCVEIGESVRGEDVYIVQSGSGEINDNLMELLIMINACKIASASRVTAVIPCFPYARQ 144
                ||  .::..:.:||:.|..:.|.|...  .:.|.|.:|.|......|..|.|:|.||....
plant   135 DGFPNL--FIQNAQGIRGQHVAFLASFSSPA--VIFEQLSVIYALPKLFVSSFTLVLPFFPTGTS 195

  Fly   145 DKKDKLAGSEDNAESKKLAKKNYDWKFRSRAPISAKLVANM-LSVAGADHIITMDLHASQIQGFF 208
            ::      .||..:.             :.|...|::::|: .|..|...::|.|:||.|.:.:|
plant   196 ER------MEDEGDV-------------ATAFTLARILSNIPTSRGGPTSLVTFDIHALQERFYF 241

  Fly   209 -DIPVDNLYAEPAVLKWIKENIPEWKNSIIVSPDAGGAKRVTSIADRLNVEFALIHKERKK---- 268
             |..:....:...:||...:::|:..|..|..||.|..||              .||:.:.    
plant   242 GDTILPCFESGIPLLKSRLQSLPDSDNISIAFPDDGAWKR--------------FHKQLQHYPTI 292

  Fly   269 -ANEVAS------MVLVGDVKDKIAILVDDMADTCGTIVHAADRLVEAGATKVYAILTHGIF 323
             .|:|..      .:..||.:.:..::|||:..:.||::.....|...||.|:.|.:|||||
plant   293 VCNKVRMGDKRIVRIKEGDAEGRHVVIVDDLVQSGGTLIECQKVLAAHGAAKISAYVTHGIF 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PrpsNP_729528.2 PrsA 48..383 CDD:223538 73/294 (25%)
PRS3NP_172540.1 PLN02297 85..411 CDD:177934 77/317 (24%)
PRTases_typeI <295..367 CDD:206754 19/60 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0462
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.