DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prps and PRPSAP1

DIOPT Version :9

Sequence 1:NP_729528.2 Gene:Prps / 39132 FlyBaseID:FBgn0036030 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_002757.2 Gene:PRPSAP1 / 5635 HGNCID:9466 Length:385 Species:Homo sapiens


Alignment Length:370 Identity:156/370 - (42%)
Similarity:213/370 - (57%) Gaps:61/370 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 KVFSGTSH---PDLAQRIVDRLGIDLGKVVTKKFSNLETCVEIGESVRGEDVYIVQSGSGEINDN 113
            :|||..|.   .:||:||.:|||.:|||.|..:.:|.||.|||.|||||:|::|:|:...::|..
Human    38 RVFSANSTAACTELAKRITERLGAELGKSVVYQETNGETRVEIKESVRGQDIFIIQTIPRDVNTA 102

  Fly   114 LMELLIMINACKIASASRVTAVIPCFPYARQDKKDKLAGSEDNAESKKLAKKNYDWKFRSRAPIS 178
            :||||||..|.|.|.|..:..|||.|||::|.                        |.|.|..|.
Human   103 VMELLIMAYALKTACARNIIGVIPYFPYSKQS------------------------KMRKRGSIV 143

  Fly   179 AKLVANMLSVAGADHIITMDLHASQIQGFFDIPVDNLYAEPAVLKWIKENIPEWKNSIIV--SPD 241
            .||:|:||:.||..||||||||..:|||||..|||||.|.|.:|::|:|.||.::|::||  |||
Human   144 CKLLASMLAKAGLTHIITMDLHQKEIQGFFSFPVDNLRASPFLLQYIQEEIPNYRNAVIVAKSPD 208

  Fly   242 AGGAKRVTSIADRLNVEFALIHKERK------------------------------KANEVASMV 276
            |  |||..|.|:||.:..|:||.|.:                              .|.|...:.
Human   209 A--AKRAQSYAERLRLGLAVIHGEAQCTELDMDDGRHSPPMVKNATVHPGLELPLMMAKEKPPIT 271

  Fly   277 LVGDVKDKIAILVDDMADTCGTIVHAADRLVEAGATKVYAILTHGIFSGPAISRINNACFEAVVV 341
            :||||..:|||:|||:.|...:.|.||:.|.|.||.|:|.:.||||.|..|...|..:..:.|||
Human   272 VVGDVGGRIAIIVDDIIDDVESFVAAAEILKERGAYKIYVMATHGILSAEAPRLIEESSVDEVVV 336

  Fly   342 TNTIPQDGHMRDCPKIQCIDVSMMFAEAVRRTHNGESVSYLFSNV 386
            |||:|.:.....||||:.:|:|::.:||:||.|||||::|||.|:
Human   337 TNTVPHEVQKLQCPKIKTVDISLILSEAIRRIHNGESMAYLFRNI 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PrpsNP_729528.2 PrsA 48..383 CDD:223538 153/365 (42%)
PRPSAP1NP_002757.2 PrsA 37..379 CDD:223538 154/366 (42%)
Pribosyltran_N 38..155 CDD:290508 56/140 (40%)
Pribosyl_synth 196..379 CDD:291252 71/184 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0462
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG60704
OrthoDB 1 1.010 - - D1043963at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.830

Return to query results.
Submit another query.