DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prps and pdha1b

DIOPT Version :9

Sequence 1:NP_729528.2 Gene:Prps / 39132 FlyBaseID:FBgn0036030 Length:388 Species:Drosophila melanogaster
Sequence 2:XP_005162743.1 Gene:pdha1b / 436672 ZFINID:ZDB-GENE-040718-96 Length:400 Species:Danio rerio


Alignment Length:119 Identity:21/119 - (17%)
Similarity:43/119 - (36%) Gaps:40/119 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   195 ITMDLHASQIQGFFDIPVDNLYAEPAVLKWIKENIPEWKNSIIVSPDAGGAKRVTSIADRLNVEF 259
            |.|:|...:..|       :..::|.|....:|.|.|.::.         :..:|::.||:    
Zfish   290 ILMELQTYRYHG-------HSMSDPGVSYRTREEIQEVRSK---------SDPITTLKDRM---- 334

  Fly   260 ALIHKERKKANEVASMVLVGDVKDKIAILVDDMA------------DTCGTIVH 301
                    .::.:||:..:.|:...|...|::.|            |.|..|.:
Zfish   335 --------ISSNMASLEEIKDIDADIRKEVEEAAQFATTDPEPPLEDLCNHIFY 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PrpsNP_729528.2 PrsA 48..383 CDD:223538 21/119 (18%)
pdha1bXP_005162743.1 PDH_E1_alph_y 68..379 CDD:274473 20/116 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0462
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.