DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prps and Pdha

DIOPT Version :9

Sequence 1:NP_729528.2 Gene:Prps / 39132 FlyBaseID:FBgn0036030 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_726945.1 Gene:Pdha / 31406 FlyBaseID:FBgn0028325 Length:443 Species:Drosophila melanogaster


Alignment Length:100 Identity:21/100 - (21%)
Similarity:32/100 - (32%) Gaps:40/100 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   297 GTIVHAADRLVEAGATK--VYAILTHGIFSGPAISRINNACFEAVVVTNTIPQDGHMRDCP---- 355
            |..|...|.|....||:  :..:.|||               ..|:.|||....||....|    
  Fly   299 GIWVDGMDVLAVRSATEFAINYVNTHG---------------PLVMETNTYRYSGHSMSDPGTSY 348

  Fly   356 ----KIQ---------------CIDVSMMFAEAVR 371
                :||               ||::.::..:.|:
  Fly   349 RTREEIQEVRQKRDPITSFKELCIELGLITTDEVK 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PrpsNP_729528.2 PrsA 48..383 CDD:223538 21/99 (21%)
PdhaNP_726945.1 TPP_enzymes 78..426 CDD:294952 21/99 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0462
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.