DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prps and LOC108179035

DIOPT Version :9

Sequence 1:NP_729528.2 Gene:Prps / 39132 FlyBaseID:FBgn0036030 Length:388 Species:Drosophila melanogaster
Sequence 2:XP_021327587.1 Gene:LOC108179035 / 108179035 -ID:- Length:167 Species:Danio rerio


Alignment Length:142 Identity:56/142 - (39%)
Similarity:80/142 - (56%) Gaps:27/142 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 KVFSGTSHP---DLAQRIVDRLGIDLGKVVTKKFSNLETCVEIGESVRGEDVYIVQSGSGEINDN 113
            :|||..|.|   :|:::|.:|||::|||.|..:.||.||.|||.|||||:.::|:|:...::|..
Zfish     9 RVFSANSTPACTELSKKITERLGVELGKSVVYQESNRETRVEIKESVRGQTIFIIQTIPRDVNTA 73

  Fly   114 LMELLIMINACKIASASRVTAVIPCFPYARQDKKDKLAGSEDNAESKKLAKKNYDWKFRSRAPIS 178
            :||||||..|.|.:.|..:..|||.|||::|                        .|.|.|..|.
Zfish    74 IMELLIMAYALKTSCAKNIIGVIPYFPYSKQ------------------------CKMRKRGSIV 114

  Fly   179 AKLVANMLSVAG 190
            .||:|:||:.||
Zfish   115 CKLLASMLAKAG 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PrpsNP_729528.2 PrsA 48..383 CDD:223538 56/142 (39%)
LOC108179035XP_021327587.1 Pribosyltran_N 9..126 CDD:316325 54/140 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1043963at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.