DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTub67C and TUBA1A

DIOPT Version :9

Sequence 1:NP_524009.2 Gene:alphaTub67C / 39130 FlyBaseID:FBgn0087040 Length:462 Species:Drosophila melanogaster
Sequence 2:NP_001257328.1 Gene:TUBA1A / 7846 HGNCID:20766 Length:451 Species:Homo sapiens


Alignment Length:462 Identity:316/462 - (68%)
Similarity:385/462 - (83%) Gaps:11/462 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MREVVSIQIGQCGIQIGNACWELYLLEHGINLDGSLKTKEELTASGSSASVGHDTSANDARTFFT 65
            |||.:||.:||.|:||||||||||.|||||..||.:.:.:.:.        |.|.|.|   |||:
Human     1 MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIG--------GGDDSFN---TFFS 54

  Fly    66 ETGNGKQVPRSIFVDLEPTVIDDVRNGCMRELYHPEQLISGKEDAANNYARGRYSIGKEVIDRVT 130
            |||.||.|||::||||||||||:||.|..|:|:||||||:||||||||||||.|:||||:||.|.
Human    55 ETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVL 119

  Fly   131 SRLQKIAEQCDSLQGFLIFHSLGGGTGSGFTSLLVERLSTDYSKKCKLDFAVYPSPKVSTAVVEP 195
            .|::|:|:||..|||||:|||.||||||||||||:||||.||.||.||:|::||:|:||||||||
Human   120 DRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEP 184

  Fly   196 YNALLTTHSTMDHSDCVFMVDNEAIYDICNNSLGVDRPAYRNLNRLIAQIVSSTTASLRFSGSMN 260
            ||::||||:|::||||.||||||||||||..:|.::||.|.||||||.|||||.||||||.|::|
Human   185 YNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALN 249

  Fly   261 VDLNEFQTNLVPFPRIHFPLVAYAPLMSAERSAHEQHAITTLTNACFESSNMMVKCDPRAGKFMA 325
            |||.||||||||:|||||||..|||::|||::.|||.::..:||||||.:|.|||||||.||:||
Human   250 VDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMA 314

  Fly   326 CCMLYRGDVVPKDVNAAVSAIKSKRHIQFVDWCPTGFKIGINYEKPAFVPDGDLAKTSRACCMLS 390
            ||:||||||||||||||::.||:||.||||||||||||:||||:.|..||.|||||..||.||||
Human   315 CCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLS 379

  Fly   391 NTTAISVAFSNLSYKFDLMFKKRAFVHWYVGEGMEEGEFTEARENIAVLERDFEEVGLDNAEEGG 455
            |||||:.|::.|.:|||||:.||||||||||||||||||:||||::|.||:|:||||:|:.|..|
Human   380 NTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGVDSVEGEG 444

  Fly   456 DEDFDEF 462
            :|:.:|:
Human   445 EEEGEEY 451

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTub67CNP_524009.2 alpha_tubulin 2..446 CDD:276955 307/443 (69%)
TUBA1ANP_001257328.1 PTZ00335 1..440 CDD:185562 312/449 (69%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 432..451 8/18 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5023
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D275336at33208
OrthoFinder 1 1.000 - - FOG0000082
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100108
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.720

Return to query results.
Submit another query.