DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTub67C and TUBE1

DIOPT Version :9

Sequence 1:NP_524009.2 Gene:alphaTub67C / 39130 FlyBaseID:FBgn0087040 Length:462 Species:Drosophila melanogaster
Sequence 2:NP_057346.1 Gene:TUBE1 / 51175 HGNCID:20775 Length:475 Species:Homo sapiens


Alignment Length:485 Identity:136/485 - (28%)
Similarity:243/485 - (50%) Gaps:67/485 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MREVVSIQIGQCGIQIGNACWELYLLEH-GINLDG-----------SLKTKEELTASGSSASVGH 53
            |.:.|.:|:||||.|||...|:|.|.|| .:|..|           ::.|:  :...|.|.|.|.
Human     1 MTQSVVVQVGQCGNQIGCCFWDLALREHAAVNQKGIYDEAISSFFRNVDTR--VVGDGGSISKGK 63

  Fly    54 DTSANDARTFFTETGNGKQVPRSIFVDLEPTVIDDVRNGCMRELYHPEQLISGKEDAANNYARGR 118
            ..|..               .|::.:|:|..|::::..|.:|:::..:|||:....:.||:|.|.
Human    64 ICSLK---------------ARAVLIDMEEGVVNEILQGPLRDVFDTKQLITDISGSGNNWAVGH 113

  Fly   119 YSIGKEVIDRVTSRLQKIAEQCDSLQGFLIFHSLGGGTGSGFTSLLVERLSTDYSKKCKLDFAVY 183
            ...|....|::..:.:|.||.||.||.|.|.||:|||||||..:.|::.|..::.:..:...::|
Human   114 KVFGSLYQDQILEKFRKSAEHCDCLQCFFIIHSMGGGTGSGLGTFLLKVLEDEFPEVYRFVTSIY 178

  Fly   184 PSPKVSTAVVEPYNALLTTHSTMDHSDCVFMVDNEAIYDICN----------------------N 226
            ||.: ...:..|||::|......:|:|||..:||::::||.:                      :
Human   179 PSGE-DDVITSPYNSILAMKELNEHADCVLPIDNQSLFDIISKIDLMVNSGKLGTTVKPKSLVTS 242

  Fly   227 SLGVDRPAYRN----LNRLIAQIVSSTTASLRFSGSMNVDLNEFQTNLVPFPRIHFPLVAYAPLM 287
            |.|..:..::.    :|.::|.::.:.|:|.||.||:|:||||...||||||::|:.:.:..||.
Human   243 SSGALKKQHKKPFDAMNNIVANLLLNLTSSARFEGSLNMDLNEISMNLVPFPQLHYLVSSLTPLY 307

  Fly   288 SAERSAHEQHAITTLTNACFESSNMMVKCDPRAGKFMACCMLYRGDVVPKDVNAAVSAIKSKRHI 352
            :..........:..:.:..|...:.:::.||:...::||.::.||:|...|:...:..:|..  :
Human   308 TLTDVNIPPRRLDQMFSDAFSKDHQLLRADPKHSLYLACALMVRGNVQISDLRRNIERLKPS--L 370

  Fly   353 QFVDWCPTGFKIGINYEKPAFVPDGDLAKTSRACCMLSNTTAISVAFSNLSYKFDLMFKKRAFVH 417
            |||.|...|:|..:....|        ...|.:...|:|.|.:...|..|..:|..::||:|.:|
Human   371 QFVSWNQEGWKTSLCSVPP--------VGHSHSLLALANNTCVKPTFMELKERFMRLYKKKAHLH 427

  Fly   418 WYVG-EGMEEGEFTEARENIAVLERDFEEV 446
            .|:. |||||..||||..:::.|.::::::
Human   428 HYLQVEGMEESCFTEAVSSLSALIQEYDQL 457

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTub67CNP_524009.2 alpha_tubulin 2..446 CDD:276955 135/482 (28%)
TUBE1NP_057346.1 epsilon_tubulin 2..457 CDD:276959 135/482 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5023
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.