DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16717 and K07C11.7

DIOPT Version :9

Sequence 1:NP_648343.1 Gene:CG16717 / 39129 FlyBaseID:FBgn0036028 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_505116.1 Gene:K07C11.7 / 179200 WormBaseID:WBGene00019479 Length:290 Species:Caenorhabditis elegans


Alignment Length:292 Identity:99/292 - (33%)
Similarity:152/292 - (52%) Gaps:50/292 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 DPTA---AWREI--SKTQRVIKVT----MKPPTTTVAPNKARVVCMSDTHSLTPYIKFDIPDGDI 66
            ||.|   .|..|  :|.|.:::..    :..|.|...| ..:|||:||||.....:  .:||||:
 Worm    28 DPDAENELWDSIKHTKVQNIVEKNAIGEINSPPTDGTP-YLKVVCISDTHEQLHNV--TVPDGDV 89

  Fly    67 FIHAGDFTKCGQLEEVEEFNTWIGALPHRHKIVIAGNHELSFDRTFTHPFQKSKSHASSSKHTGM 131
            .|||||||..|:.||:.:||..:...||::|:|:||||||.||            |..:.     
 Worm    90 LIHAGDFTNNGKREELIKFNEEMTRFPHKYKLVVAGNHELGFD------------HDENQ----- 137

  Fly   132 SILDDLPTLGNAKENLESAVQTQNVRDVLTNCRYLEDELLEIWGIQIYGSPWQPEFCRWAFNVPR 196
                      ..:::.:..:.|::..::|||..||:|:.:.|.|:..:||.:.| ...:.|...|
 Worm   138 ----------GERQDADKGLGTEDGYNILTNVTYLQDKGVTIDGVTFFGSSYHP-LRGFPFYRNR 191

  Fly   197 GTACLDKWNQIPEGIDILVTHTPPVGH----GDLCCSGVRAGCVELLSTVQQRVRPKYHVFGHVH 257
            .....:.|..:|...::|:|||||:|:    ||     .|.||.:||.|| :|::|.||:|||||
 Worm   192 AEQLAECWKAVPNDTNVLITHTPPLGYLDQFGD-----ERWGCRDLLKTV-ERIQPAYHIFGHVH 250

  Fly   258 EGYGITSDGRIIFVNASTCDINYLPNNAPIVF 289
            |.:|:.|:|...|:||:.|:........||||
 Worm   251 EQHGVLSNGNTTFINAAQCNKGNQIQTRPIVF 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16717NP_648343.1 MPP_239FB 43..274 CDD:277325 83/234 (35%)
K07C11.7NP_505116.1 Metallophos 67..252 CDD:278574 77/220 (35%)
MPP_239FB 68..267 CDD:277325 83/234 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160166631
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57786
OrthoDB 1 1.010 - - D1301937at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101637
Panther 1 1.100 - - O PTHR12905
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.860

Return to query results.
Submit another query.