DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CNMaR and trhra

DIOPT Version :9

Sequence 1:NP_001027122.2 Gene:CNMaR / 39127 FlyBaseID:FBgn0053696 Length:480 Species:Drosophila melanogaster
Sequence 2:XP_687246.4 Gene:trhra / 558878 ZFINID:ZDB-GENE-100922-18 Length:393 Species:Danio rerio


Alignment Length:382 Identity:92/382 - (24%)
Similarity:147/382 - (38%) Gaps:111/382 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 VLCCTGSIGNILSVFVFFRTKLRKLSSSFYLAALAVSDTCFL--AGL--------FAQWLNFLNV 122
            ::|..|.:||::.:.|...||..:..::.||.:|||:|...|  |||        ..||      
Zfish    28 LICGVGIVGNVMVILVVLTTKHMRTPTNCYLVSLAVADLMVLTAAGLPNITEILFGGQW------ 86

  Fly   123 DIYNQNYF-CQFFTFFSYL---ASFCSVWFVVAFTVERFIAVIYPLKRQTMCTVRRAKIVLFCLT 183
             :|  .|. |...|:|.||   ||.||   :.|||:||:||:.:|:|.|.|||:.|||.::..:.
Zfish    87 -VY--GYAGCLSITYFQYLGINASSCS---ITAFTIERYIAICHPIKAQFMCTLSRAKKIIVLVW 145

  Fly   184 LVGCLHCLPYIVIAKPVFMPKLNTTICDLNSEYKEQLALFNYW-DTIVVYAVPFTTIAVLNTCTG 247
            ::..|:|:.:..:.........|..:.....:...:|.|..|: |..|.|.:|.....||     
Zfish   146 VLTSLYCVMWFYLLDTREKVYDNAVLVTCGYKVSRELYLPIYFTDYAVFYVIPLLLATVL----- 205

  Fly   248 CTVWKFATVRRTLTMHKMKPQTNSMPSNSSNSSGGASSAVASYRLSASLKRQKSTGTHPSGQHNV 312
                 :..:.|.|.:       |.:||:...|.                                
Zfish   206 -----YGLIARILFL-------NPLPSDPKESR-------------------------------- 226

  Fly   313 ANRQTDDQEQQQQSQQHQINNCQHHCEITQKPARRKVQNSSQLKVTKMLLIVSTVFVCLNLPSCL 377
                   :..:::|..|  .|.:.....|...:||        :|||||.:|..:|..|.:|...
Zfish   227 -------RNWKKESSVH--GNSRSSSNSTTVASRR--------QVTKMLAVVVILFALLWMPYRT 274

  Fly   378 LRIEAYWETESARNQNSTIALQYIFHAFFI-------TNFGINFVLYCVSGQNFRKA 427
            |.:           .||.:...|:...|.:       .|..||.::|....|.||.|
Zfish   275 LVV-----------VNSFLKEAYLDTCFLLFCRLCIYMNSAINPIIYNAMSQKFRAA 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CNMaRNP_001027122.2 7tm_4 73..>262 CDD:304433 59/203 (29%)
trhraXP_687246.4 7tm_4 28..>171 CDD:304433 49/154 (32%)
7tm_1 36..310 CDD:278431 85/362 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.