DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CNMaR and Olr418

DIOPT Version :9

Sequence 1:NP_001027122.2 Gene:CNMaR / 39127 FlyBaseID:FBgn0053696 Length:480 Species:Drosophila melanogaster
Sequence 2:NP_001000825.1 Gene:Olr418 / 405114 RGDID:1333496 Length:310 Species:Rattus norvegicus


Alignment Length:238 Identity:50/238 - (21%)
Similarity:89/238 - (37%) Gaps:49/238 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 EDEEMLRIAFFIGHFVHQYYIPVLCCTGSIGNILSVFVFFRTKLRKLSSSFYLAALAVSDTCFLA 110
            ||::.|.|.|.      ..|:..|.     ||:|.:.|.......:....|:|:.|:::|.||..
  Rat    23 EDQKPLFILFL------TIYLITLA-----GNLLIILVIHSDPHLQTPMYFFLSFLSLTDICFTT 76

  Fly   111 GLFAQWL-NFLNVDIYNQNYFCQFFTFFSYLASFCSVWFVVAFTVERFIAVIYPLKRQTMCTVRR 174
            .:..:.| |||:.........|....:|.|.........:.....:|::|:..|....|:....|
  Rat    77 TIVPKMLVNFLSEKKTISYAGCLTQMYFLYALGNSDSCLLAVMAFDRYVAICNPFHYVTIMNHHR 141

  Fly   175 AKIVLFCLTLV--GC----LHCLPYIVIAKPVFMPKLNTT---ICDL--------NSEYKEQLAL 222
                  |:.||  .|    ||.|.:.::...:.....|..   :|||        :|.:..::.:
  Rat   142 ------CVLLVTFSCSFPHLHSLLHTLLLNLLTFCDSNVIHHFLCDLSPLIKLSCSSTFVNEIVI 200

  Fly   223 FNYWDTIVVYAVPFTTIAVLNTCTGCTVWKFATVRRTLTMHKM 265
            ..  :..:|...||..||            |:.:|..:|:.|:
  Rat   201 VT--EGALVLVTPFLCIA------------FSYIRILITVLKI 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CNMaRNP_001027122.2 7tm_4 73..>262 CDD:304433 41/206 (20%)
Olr418NP_001000825.1 7tm_4 32..308 CDD:304433 46/229 (20%)
7tm_1 42..290 CDD:278431 43/208 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BRWX
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.