DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CNMaR and MsR1

DIOPT Version :9

Sequence 1:NP_001027122.2 Gene:CNMaR / 39127 FlyBaseID:FBgn0053696 Length:480 Species:Drosophila melanogaster
Sequence 2:NP_001261324.1 Gene:MsR1 / 38298 FlyBaseID:FBgn0035331 Length:556 Species:Drosophila melanogaster


Alignment Length:518 Identity:109/518 - (21%)
Similarity:183/518 - (35%) Gaps:163/518 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 VHQYYIPVLCCTGSIGNILSVFVFFRTKLRKLSSSFYLAALAVSDTCFLAGLFAQWLNFLNVDI- 124
            :|.|...|:|..|:|.|.|::.|..|.::|..:::. |..|||:|       .|..|.::...| 
  Fly    27 MHGYVSLVVCILGTIANTLNIIVLTRREMRSPTNAI-LTGLAVAD-------LAVMLEYIPYTIH 83

  Fly   125 ---------------YNQNYFCQFFTFFSYLASFCSVWFVVAFTVERFIAVIYPLKRQTMCTVRR 174
                           |:...|.:|.:.|:.:....|:|..|...|.|:|||.||.|.:..|.:|.
  Fly    84 DYILTDSLPREEKLSYSWACFIKFHSIFAQVLHTISIWLTVTLAVWRYIAVGYPQKNRVWCGMRT 148

  Fly   175 AKIVLFCLTLVGCLHCLP--YIVIAKPVFMPKLNTTICDLNS--------EYKEQLALFNYWDTI 229
            ..|.:....:|..|...|  |::.|...::.:|:.....:||        :|:.:|....   |.
  Fly   149 TIITITTAYVVCVLVVSPSLYLITAITEYVDQLDMNGKVINSIPMTQYVIDYRNELLSAR---TA 210

  Fly   230 VVYAVPFTTIAVLNTCTGCTVWKFATVRRTLTMHKMKPQTNSMPSN--------SSNSSGGAS-- 284
            .:.|.|  |.|.||.    |||..|:...|.|.....|..:.:..|        |..:...||  
  Fly   211 ALNATP--TSAPLNE----TVWLNASTLLTSTTTAAPPTPSPVVRNVTVYRLYHSDLALHNASLQ 269

  Fly   285 ------------------SAVASYRLSASL----KRQKSTGTHP------SGQHNVANRQTDDQE 321
                              ..:.|.||..:|    :|:|...:.|      :|..:.||.:..|:.
  Fly   270 NATFLIYSVVIKLIPCIALTILSVRLILALLEAKRRRKKLTSKPATPGASNGTKSPANGKAADRP 334

  Fly   322 QQQQSQQHQINNCQHHCEITQKPARRKVQNSSQLKVTKMLLIVSTVFVCLNLPSCLL-------- 378
            ::                 ..|...::.|..   :.|:|||.|..:|:....|..::        
  Fly   335 RK-----------------NSKTLEKEKQTD---RTTRMLLAVLLLFLITEFPQGIMGLLNAVLG 379

  Fly   379 ---RIEAYWETESARNQNSTIALQYIFHAFFITNFGINFVLYCVSGQNFRKAVLSIFR------- 433
               .::.|            :.|..:.....:.|..|||:|||...:.||.....:||       
  Fly   380 DVFYLQCY------------LRLSDLMDILALINSSINFILYCSMSKQFRTTFTLLFRPKFLDKW 432

  Fly   434 --------RVSSAQREA---------------------GNTQVTVSEYCRNTGTSTRRRMMTQ 467
                    ..:.|:|.|                     ..||||.. :.|:.|   ||.::::
  Fly   433 LPVAQDEMAAARAERSAVAPVLEKGRQQPQVVMASTTTNITQVTNLXHRRSRG---RRTLLSR 492

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CNMaRNP_001027122.2 7tm_4 73..>262 CDD:304433 55/214 (26%)
MsR1NP_001261324.1 7tm_4 30..427 CDD:304433 97/445 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467306
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.