DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CNMaR and MsR2

DIOPT Version :9

Sequence 1:NP_001027122.2 Gene:CNMaR / 39127 FlyBaseID:FBgn0053696 Length:480 Species:Drosophila melanogaster
Sequence 2:NP_001261323.1 Gene:MsR2 / 38296 FlyBaseID:FBgn0264002 Length:647 Species:Drosophila melanogaster


Alignment Length:434 Identity:89/434 - (20%)
Similarity:167/434 - (38%) Gaps:88/434 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 FVHQYYIPVLCCTGSIGNILSVFVFFRTKLRKLSSSFYLAALAVSDTCFLAGLFAQWLN--FLNV 122
            :.|.|:..::|..|:|.|.|::.|..|.::|..:::. |..|||:|...:.......::  .|:|
  Fly    24 YFHGYFSLIVCILGTIANTLNIIVLTRREMRSPTNAI-LTGLAVADLAVMLEYIPYTVHDYILSV 87

  Fly   123 DI-------YNQNYFCQFFTFFSYLASFCSVWFVVAFTVERFIAVIYPLKRQTMCTVRRAKIVLF 180
            .:       |:...|.:|.:.|..:....|:|..|...|.|:|||.||.:.:..|.:|...|.:.
  Fly    88 RLPREEQLSYSWACFIKFHSVFPQVLHTISIWLTVTLAVWRYIAVSYPQRNRIWCGMRTTLITIA 152

  Fly   181 CLTLVGCLHCLP--YIVIAKPVFMPKLNTT------------ICDLNSEYKEQLALFNYWDTIVV 231
            ...:|..|...|  |:|.|...|:..|:..            |.|.|.:.:..:.:.:.....|.
  Fly   153 TAYVVCVLVVSPWLYLVTAIAKFLETLDANGKTIASVPLSQYILDYNRQDEVTMQVMSSTTPDVS 217

  Fly   232 YAVP-------------FTTIAVLNT-CTGCTVWKFATVRRTLTMHKMKPQTNSMPSNSSNSSGG 282
            :|:|             .||:..|.| .||.|. ..:...|.:|::|:.....::......::..
  Fly   218 WAIPSDSANGTAVSLLSLTTVIPLTTLSTGVTT-SSSLGERNVTVYKLYHSALALRDRQFRNATF 281

  Fly   283 A------------SSAVASYRLSASL----KRQKSTGTHPSG-QHNVANRQTDDQEQQQQSQQHQ 330
            .            :..:.|.||..:|    :|:|....|.:. ...:.|.:.....|.:.     
  Fly   282 LIYSVLIKLIPCFALTILSVRLIGALLEAKRRRKILACHAANDMQPIVNGKVVIPTQPKS----- 341

  Fly   331 INNCQHHCEITQKPARRKVQNSSQLKVTKMLLIVSTVFVCLNLPSCLLRI------EAYWETESA 389
                   |::.:|..:..       :.|:|||.|..:|:....|..::.:      :|::     
  Fly   342 -------CKLLEKEKQTD-------RTTRMLLAVLLLFLVTEFPQGIMGLLNVLLGDAFF----- 387

  Fly   390 RNQNSTIALQYIFHAFFITNFGINFVLYCVSGQNFRKAVLSIFR 433
              ....:.|..:.....:.|..|||:|||...:.||.....:||
  Fly   388 --LQCYLKLSDLMDILALINSSINFILYCSMSRQFRSTFALLFR 429

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CNMaRNP_001027122.2 7tm_4 73..>262 CDD:304433 53/225 (24%)
MsR2NP_001261323.1 7tm_4 28..429 CDD:304433 86/428 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467307
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.