DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CNMaR and CG15614

DIOPT Version :9

Sequence 1:NP_001027122.2 Gene:CNMaR / 39127 FlyBaseID:FBgn0053696 Length:480 Species:Drosophila melanogaster
Sequence 2:NP_611168.2 Gene:CG15614 / 36899 FlyBaseID:FBgn0034168 Length:469 Species:Drosophila melanogaster


Alignment Length:432 Identity:77/432 - (17%)
Similarity:139/432 - (32%) Gaps:146/432 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 IPVLCCTGSIGNILSVFVFFRTKLRKLSSSFYLAALAVSD--TCFLAGLFAQWLNFLNVDIYNQN 128
            :|.|...|...|.::..||.|.|:.. |:..|||||:..|  :|.|          :.:...:::
  Fly    46 VPTLSAFGLCTNFINAVVFMRPKMTP-SAFSYLAALSWMDCISCLL----------ITMTALSRS 99

  Fly   129 YFCQFFTFFSYLASFCSVWF----------VVAFTVERFIAVIYPLKRQT----MCTVRRAKIVL 179
            ||....|:.:|...:.:..|          :...:::||| .:...||..    .|..:.|:.::
  Fly   100 YFYSSPTWITYDYQWQTPLFGISTGGANLILACLSLDRFI-YLSCFKRNNGAPRFCRRKVARCII 163

  Fly   180 FCLTLVGCLHCLPYIVIAKPVFMPKLNTTICDLNSEYKEQLALFNYWDTIVVYA-VPFTTIAVLN 243
            .....:..:..:||..    ||....:.| |.:...|.........|.|..:.| :|...:.:.|
  Fly   164 VVAIGISIVVNMPYFF----VFYVSDSGT-CHVTEFYYTNFYKVQNWFTFALLALLPAIFLVIGN 223

  Fly   244 TCTGCTVWKFATVRRTLTMHKMKPQTNSMPSNSSNSSGGASSAVASYRLSASLKRQKSTGTHPSG 308
               |..:..|    |..|......|.|:..:||..::                ||.         
  Fly   224 ---GAIIIAF----RKWTKQSRICQANNPAANSRTTA----------------KRY--------- 256

  Fly   309 QHNVANRQTDDQEQQQQSQQHQINNCQHHCEITQKPARRKVQNSSQLKVTKMLLIVSTVFVCLNL 373
                                      ||                 |:|:|..::||.|:::...|
  Fly   257 --------------------------QH-----------------QMKLTISIVIVITLYLFGEL 278

  Fly   374 P-----------------------SCLLRIEAYWETESARNQNSTIALQYIFHAFFITNFGINFV 415
            |                       |.:.::|....|.:|...:..|.:..:.:..|:..|     
  Fly   279 PAHMTSRKSSLNLLFGGDANKVDDSFIEQLEVICITLNALQLSLNIVVYAVINPSFMPEF----- 338

  Fly   416 LYCVSGQN--------FRKAVLSIFRRVSSAQREAGNTQVTV 449
            ..|:.|.:        || ||...:||....:::....:..|
  Fly   339 FLCLKGTSDVCFGLCCFR-AVRRTWRRCQDKRKQKATAEERV 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CNMaRNP_001027122.2 7tm_4 73..>262 CDD:304433 42/205 (20%)
CG15614NP_611168.2 7tm_4 48..>242 CDD:304433 44/217 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469447
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR46641
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.