DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CNMaR and GPR142

DIOPT Version :9

Sequence 1:NP_001027122.2 Gene:CNMaR / 39127 FlyBaseID:FBgn0053696 Length:480 Species:Drosophila melanogaster
Sequence 2:NP_861455.1 Gene:GPR142 / 350383 HGNCID:20088 Length:462 Species:Homo sapiens


Alignment Length:409 Identity:67/409 - (16%)
Similarity:113/409 - (27%) Gaps:181/409 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 IPVLCCTGSIGNILSVFVFFRTKLRKLS------SSFYLAALAVSD-----TCFLAGLFAQW--- 116
            |||:..:..:|..|.|.:.....|.:|:      |.:||.||..||     ....||...|.   
Human   158 IPVIYYSVLLGLGLPVSLLTAVALARLATRTRRPSYYYLLALTASDIIIQVVIVFAGFLLQGAVL 222

  Fly   117 --------LNFLNVDIYNQNYFCQFFTFFSYLASFCSVWFVVAFTVERFIAVIYPLKRQTMCTVR 173
                    :...|:              ..:.|:..|||..:..||:|:.|:.:||..:...:..
Human   223 ARQVPQAVVRTANI--------------LEFAANHASVWIAILLTVDRYTALCHPLHHRAASSPG 273

  Fly   174 RAKIVLFCLTLVGCLHCLPYIVIAKPVFMPKLNTTICDLNSEYKEQLALFNYW------DT---- 228
            |.:..:..:.....|..:|:                               ||      ||    
Human   274 RTRRAIAAVLSAALLTGIPF-------------------------------YWWLDMWRDTDSPR 307

  Fly   229 -----------IVVYAVPFTTIAVLNTCTGCTVWKFATVRRTLTMHKMKPQTNSMPSNSSNSSGG 282
                       :.||.:|.....|.|:         |.:.|                        
Human   308 TLDEVLKWAHCLTVYFIPCGVFLVTNS---------AIIHR------------------------ 339

  Fly   283 ASSAVASYRLSASLKRQKSTGTHPSGQHNVANRQTDDQEQQQQSQQHQINNCQHHCEITQKPARR 347
                         |:|:..:|..|                                         
Human   340 -------------LRRRGRSGLQP----------------------------------------- 350

  Fly   348 KVQNSSQLKVTKMLLIVSTVFVCLNLPSCLLRIEAYWETESARNQNSTIALQYIFHAFFITNFGI 412
            :|..|     |.:||.::|:|..|..|...:.:...:.....|:....:||. :.:...:.:...
Human   351 RVGKS-----TAILLGITTLFTLLWAPRVFVMLYHMYVAPVHRDWRVHLALD-VANMVAMLHTAA 409

  Fly   413 NFVLYCVSGQNFRKAVLSI 431
            ||.|||...:.||..|..:
Human   410 NFGLYCFVSKTFRATVRQV 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CNMaRNP_001027122.2 7tm_4 73..>262 CDD:304433 40/231 (17%)
GPR142NP_861455.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 87..123
7tm_1 176..414 CDD:278431 55/375 (15%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165157875
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D421120at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.