DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CNMaR and Mlnr

DIOPT Version :9

Sequence 1:NP_001027122.2 Gene:CNMaR / 39127 FlyBaseID:FBgn0053696 Length:480 Species:Drosophila melanogaster
Sequence 2:NP_852029.3 Gene:Mlnr / 252859 RGDID:621262 Length:352 Species:Rattus norvegicus


Alignment Length:422 Identity:102/422 - (24%)
Similarity:162/422 - (38%) Gaps:122/422 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 VHQYYIPVLCCTGSIGNILSVFVFFRTKLRKLSSSFYLAALAVSDTCFL--AG-------LFAQW 116
            |..:.:.::|..|.:||.:.:.|...::.....::.||.:||::|...|  ||       |...|
  Rat    24 VSVFLVLLVCTLGIVGNAMVILVVLTSRDMHTPTNCYLVSLALADLLVLLAAGLPNVSDSLVGHW 88

  Fly   117 LNFLNVDIYNQNYFCQFFTFFSYLASFCSVWFVVAFTVERFIAVIYPLKRQTMCTVRRAKIVLFC 181
                   ||.: ..|...|:|.||....|.:.::||||||:||:.:||:.||:|||.|||.::..
  Rat    89 -------IYGR-AGCLGITYFQYLGINVSSFSILAFTVERYIAICHPLRAQTVCTVARAKRIIAG 145

  Fly   182 LTLVGCLHCLPYIVIAKPVFMPKLNTTICD---LNSEYKEQLALFNYWDTIVVYAVPFTTIAVLN 243
            :..|..|:||.:.      |:..||  :.|   |...||....|:     :.:|.:.|....:  
  Rat   146 IWGVTSLYCLLWF------FLVDLN--VRDNQRLECGYKVPRGLY-----LPIYLLDFAVFFI-- 195

  Fly   244 TCTG---CTVWKFATVRRTLTMHKMKPQTNSMPSNSSNSSGGASSAVASYRLSASLKRQKSTGTH 305
               |   .|:..:..:.|.|....:..:                        :...:||      
  Rat   196 ---GPLLVTLVLYGLIGRILFQSPLSQE------------------------AWQKERQ------ 227

  Fly   306 PSGQHNVANRQTDDQEQQQQSQQHQINNCQHHCEITQKPARRKVQNSSQLKVTKMLLIVSTVFVC 370
            |.||...|.                 .||          :|.|   ||:.:.|:||.:|..:|..
  Rat   228 PHGQSEAAP-----------------GNC----------SRAK---SSRKQATRMLAVVVLLFAV 262

  Fly   371 LNLPSCLLRIEAYWETESARNQNSTIALQYI-------FHAFFITNFGINFVLYCVSGQNFRKAV 428
            |..|...|.:           .||.:|..::       ......||..:|.|:|.:..|.||.|.
  Rat   263 LWTPYRTLVL-----------LNSFVAQPFLDPWVLLFCRTCVYTNSAVNPVVYSLMSQKFRAAF 316

  Fly   429 LSI-FRRVSSAQREAGNTQVTVSEYCRNTGTS 459
            |.: :.|.:..||.|  .:|..|.|.....||
  Rat   317 LKLCWCRAAGPQRRA--ARVLTSNYSAAQETS 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CNMaRNP_001027122.2 7tm_4 73..>262 CDD:304433 58/203 (29%)
MlnrNP_852029.3 7tm_4 37..>161 CDD:304433 44/137 (32%)
7tm_1 39..305 CDD:278431 84/362 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.