DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CNMaR and T02D1.4

DIOPT Version :9

Sequence 1:NP_001027122.2 Gene:CNMaR / 39127 FlyBaseID:FBgn0053696 Length:480 Species:Drosophila melanogaster
Sequence 2:NP_503104.2 Gene:T02D1.4 / 187984 WormBaseID:WBGene00011371 Length:446 Species:Caenorhabditis elegans


Alignment Length:295 Identity:69/295 - (23%)
Similarity:116/295 - (39%) Gaps:73/295 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ITSSSGNITATTEADFSSSLGESNVTEYNTTEMDANESAGEDEEMLRIA----------FFIGH- 59
            |.|||.:|::..||           |:...|||....|..:.||..|||          :.:|: 
 Worm    40 INSSSTSISSQEEA-----------TDDPLTEMLDRFSRIQQEECDRIANLCENRQLYTWLVGYG 93

  Fly    60 FVHQYYIPVLCCTGSIGNIL---SVFVFFRTKLRKLSSSFYLAALAVSDTCFL---AGLFAQWLN 118
            |:   ::.:|...|::.|:|   |..:.:...:|.|.:...:.:|.:  .|.|   ..:.:.|.:
 Worm    94 FI---FVFLLALFGNVVNLLIYNSDHIKYYIAIRMLCTRLLMNSLTL--ICMLPQALRIVSAWDS 153

  Fly   119 FLNV-DIYNQNYFCQFFTFFSYLASFCSVWFVVAFTVERFIAVIYPLKRQTMCTVRRAKIVLFCL 182
            ..:: :||...|..|.  :|..|..||::|..|..|.|.::.|.:|...:::||.|......|.:
 Worm   154 DSHINEIYWVYYPYQI--YFVNLFGFCAMWLTVLMTAECYLHVFFPSHSKSLCTKRNLSRSYFII 216

  Fly   183 TLVGCL---------------HC---LPYIVIAKPVFMPKLNTTICDLNSEYKEQLALF-NYWDT 228
            .:||.|               ||   :|.|..::...|      ||      .|::..| |....
 Worm   217 LVVGALLALMYKFNRSVTLSTHCNRVIPTIHASEDFVM------IC------LEKIHTFANLLFA 269

  Fly   229 IVVYAVPFTTIAVLNTCTGCTVWKFATVRRTLTMH 263
            |||      .:.:|.......:||....|.....|
 Worm   270 IVV------PMGLLLFMAASILWKLVLKRSDFVSH 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CNMaRNP_001027122.2 7tm_4 73..>262 CDD:304433 48/214 (22%)
T02D1.4NP_503104.2 7tmA_FMRFamide_R-like 88..377 CDD:320109 52/236 (22%)
TM helix 1 90..114 CDD:320109 6/26 (23%)
TM helix 2 122..145 CDD:320109 5/24 (21%)
TM helix 3 166..188 CDD:320109 7/23 (30%)
TM helix 4 211..227 CDD:320109 4/15 (27%)
TM helix 5 259..282 CDD:320109 6/28 (21%)
TM helix 6 304..329 CDD:320109
TM helix 7 345..370 CDD:320109
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D421120at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.