DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CNMaR and srx-60

DIOPT Version :9

Sequence 1:NP_001027122.2 Gene:CNMaR / 39127 FlyBaseID:FBgn0053696 Length:480 Species:Drosophila melanogaster
Sequence 2:NP_504895.2 Gene:srx-60 / 187858 WormBaseID:WBGene00005951 Length:300 Species:Caenorhabditis elegans


Alignment Length:185 Identity:40/185 - (21%)
Similarity:75/185 - (40%) Gaps:32/185 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 IGNILSVFVFFRT-KLRKLSSSF-YLAAL-----AVSDTCFLAGLFAQWLNFLNVDIYNQ----- 127
            ||::|:..:.... ||..|::|| ||.|.     |:....||       |.|..:.|.:|     
 Worm    17 IGSVLNFSILIAIYKLPALNNSFGYLTANQAIVDALHSVIFL-------LYFCPMVILDQPIMKS 74

  Fly   128 -NYFCQFFTFFSYLASFCSVWFVVAFTVERFIAVIYPLKRQTMCTVRRAKIVLFCLTLVG-CLHC 190
             ::....|..|.|..|..:.:.:   ::.||.||..|||.:...:.:....::..|.:.. .|..
 Worm    75 YSFIVGCFLLFCYELSVLTHFLI---SINRFCAVWVPLKYEKWFSRKNTSSIIILLWIFEVALAI 136

  Fly   191 LPYIVIAKPVFMPKL------NTTICDLNSEYKEQLALFNYWDTIVVYAVPFTTI 239
            :.|.::....::.::      ||..|...:.|.:.:.  |.....:|..|..:|:
 Worm   137 VFYQILCHVAYLEEIHFIQFTNTKFCGFVAWYDDFVK--NSVIIAIVVCVDISTV 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CNMaRNP_001027122.2 7tm_4 73..>262 CDD:304433 40/185 (22%)
srx-60NP_504895.2 TM helix 1 8..31 CDD:381740 3/13 (23%)
7TM_GPCR_Srx 12..266 CDD:370981 40/185 (22%)
TM helix 2 40..62 CDD:381740 7/28 (25%)
TM helix 3 77..99 CDD:381740 4/24 (17%)
TM helix 4 122..147 CDD:381740 3/24 (13%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D421120at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.