DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CNMaR and GPR139

DIOPT Version :9

Sequence 1:NP_001027122.2 Gene:CNMaR / 39127 FlyBaseID:FBgn0053696 Length:480 Species:Drosophila melanogaster
Sequence 2:NP_001002911.1 Gene:GPR139 / 124274 HGNCID:19995 Length:353 Species:Homo sapiens


Alignment Length:422 Identity:85/422 - (20%)
Similarity:150/422 - (35%) Gaps:119/422 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 FVHQYYIPVLCCTGSIGNILSVFVFFRTKLRKLSSSF-YLAALAVSDTCFLAGLFAQWLNFLNVD 123
            ||...|..:|.|.|...|||:|.:..:...|:..||: ||.|||.:|...|  .|..:::||..|
Human    27 FVPVVYYSLLLCLGLPANILTVIILSQLVARRQKSSYNYLLALAAADILVL--FFIVFVDFLLED 89

  Fly   124 IYNQNYFCQ----FFTFFSYLASFCSVWFVVAFTVERFIAVIYPLKRQTMCTVRRAKIVLFCLTL 184
            ........|    ......:.:...|:|..|..|::|:|||.:|||..|:....|.:.|:..:.:
Human    90 FILNMQMPQVPDKIIEVLEFSSIHTSIWITVPLTIDRYIAVCHPLKYHTVSYPARTRKVIVSVYI 154

  Fly   185 VGCLHCLPYIVIAKPVFMPKLNTTICDLNSEYKEQLALFNYWDTIVVYAVPFTTIAVLNTCTGCT 249
            ...|..:||      .:.|.:.|.  |..|.....:.::.:..|  ||.||.:...:||      
Human   155 TCFLTSIPY------YWWPNIWTE--DYISTSVHHVLIWIHCFT--VYLVPCSIFFILN------ 203

  Fly   250 VWKFATVRRTLTMHKMKPQTNSMPSNSSNSSGGASSAVASYRLSASLKRQKSTGTHPSGQHNVAN 314
                     ::.::|::.::|                   :||     |..|||           
Human   204 ---------SIIVYKLRRKSN-------------------FRL-----RGYSTG----------- 224

  Fly   315 RQTDDQEQQQQSQQHQINNCQHHCEITQKPARRKVQNSSQLKVTKMLLIVSTVFVCLNLPSCLLR 379
                                                     |.|.:|..::::|..|..|..::.
Human   225 -----------------------------------------KTTAILFTITSIFATLWAPRIIMI 248

  Fly   380 IEAYWETESARNQNSTIA--LQYIFHAFFITNFGINFVLYCVSGQNFRKAVLSIFRRVSSAQREA 442
            :   :....|..||..:.  :..|.:...:.|..|||.|||...:.||....:..:.....|::.
Human   249 L---YHLYGAPIQNRWLVHIMSDIANMLALLNTAINFFLYCFISKRFRTMAAATLKAFFKCQKQP 310

  Fly   443 ------GNTQVTVSEYCRNTGTSTRRRMMTQH 468
                  .|..:|.|.:.....:...:.::.|:
Human   311 VQFYTNHNFSITSSPWISPANSHCIKMLVYQY 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CNMaRNP_001027122.2 7tm_4 73..>262 CDD:304433 48/193 (25%)
GPR139NP_001002911.1 7tmA_GPR139 27..296 CDD:320585 80/374 (21%)
TM helix 1 29..53 CDD:320585 8/23 (35%)
TM helix 2 63..85 CDD:320585 8/23 (35%)
TM helix 3 102..124 CDD:320585 3/21 (14%)
TM helix 4 147..163 CDD:320585 2/15 (13%)
TM helix 5 181..204 CDD:320585 7/39 (18%)
TM helix 6 227..249 CDD:320585 5/21 (24%)
TM helix 7 264..289 CDD:320585 8/24 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165157872
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.