DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SPINT4 and spint1b

DIOPT Version :9

Sequence 1:NP_848550.1 Gene:SPINT4 / 391253 HGNCID:16130 Length:99 Species:Homo sapiens
Sequence 2:NP_001104693.1 Gene:spint1b / 797346 ZFINID:ZDB-GENE-071218-1 Length:499 Species:Danio rerio


Alignment Length:51 Identity:20/51 - (39%)
Similarity:26/51 - (50%) Gaps:0/51 - (0%)


- Green bases have known domain annotations that are detailed below.


Human    41 CKLDMNFGSCYEVHFRYFYNRTSKRCETFVFSGCNGNLNNFKLKIEREVAC 91
            |......|.|.....|:.||..|:|||.|:|.||..|.||:..:.|.:.||
Zfish   235 CLTPKKTGPCRASFIRWNYNAASRRCEQFIFGGCMENSNNYLSETECQNAC 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SPINT4NP_848550.1 KU 39..92 CDD:238057 20/51 (39%)
spint1bNP_001104693.1 MANEC 31..116 CDD:284837
PKD 148..225 CDD:214510
Kunitz_BPTI 235..285 CDD:278443 18/49 (37%)
LDLa 308..342 CDD:238060
Kunitz_BPTI 363..413 CDD:278443
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C194325700
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4295
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
NCBI 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.