powered by:
Protein Alignment SPINT4 and T21D12.7
DIOPT Version :9
Sequence 1: | NP_848550.1 |
Gene: | SPINT4 / 391253 |
HGNCID: | 16130 |
Length: | 99 |
Species: | Homo sapiens |
Sequence 2: | NP_001343686.1 |
Gene: | T21D12.7 / 24104914 |
WormBaseID: | WBGene00020648 |
Length: | 661 |
Species: | Caenorhabditis elegans |
Alignment Length: | 44 |
Identity: | 20/44 - (45%) |
Similarity: | 28/44 - (63%) |
Gaps: | 0/44 - (0%) |
- Green bases have known domain annotations that are detailed below.
Human 56 RYFYNRTSKRCETFVFSGCNGNLNNFKLKIEREVACVAKYKPPR 99
||:::.:||.|..|.|:||.||.||||.|.|..:.|.::...||
Worm 154 RYYFDSSSKTCRPFAFTGCGGNENNFKGKGECMMFCSSEIICPR 197
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C161450455 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4295 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
1 |
0.950 |
- |
0 |
Normalized mean entropy |
S6867 |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.780 |
|
Return to query results.
Submit another query.