DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SPINT4 and T21D12.7

DIOPT Version :9

Sequence 1:NP_848550.1 Gene:SPINT4 / 391253 HGNCID:16130 Length:99 Species:Homo sapiens
Sequence 2:NP_001343686.1 Gene:T21D12.7 / 24104914 WormBaseID:WBGene00020648 Length:661 Species:Caenorhabditis elegans


Alignment Length:44 Identity:20/44 - (45%)
Similarity:28/44 - (63%) Gaps:0/44 - (0%)


- Green bases have known domain annotations that are detailed below.


Human    56 RYFYNRTSKRCETFVFSGCNGNLNNFKLKIEREVACVAKYKPPR 99
            ||:::.:||.|..|.|:||.||.||||.|.|..:.|.::...||
 Worm   154 RYYFDSSSKTCRPFAFTGCGGNENNFKGKGECMMFCSSEIICPR 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SPINT4NP_848550.1 KU 39..92 CDD:238057 17/35 (49%)
T21D12.7NP_001343686.1 Kunitz_BPTI 31..86 CDD:278443
Lustrin_cystein 91..131 CDD:317074
Kunitz_BPTI 136..189 CDD:278443 17/34 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C161450455
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4295
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S6867
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.780

Return to query results.
Submit another query.