DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18180 and si:dkey-238d18.3

DIOPT Version :9

Sequence 1:NP_648341.1 Gene:CG18180 / 39125 FlyBaseID:FBgn0036024 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001373176.1 Gene:si:dkey-238d18.3 / 795978 ZFINID:ZDB-GENE-131127-38 Length:272 Species:Danio rerio


Alignment Length:201 Identity:63/201 - (31%)
Similarity:93/201 - (46%) Gaps:17/201 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 GTIIANDWILTAAHC---LTGDYVEI--HYGSNWGWNGAYRQTVRRDNFISHPDWPSQG--GRDI 125
            |::|...|:||||||   ....||.:  |..|:   |....|.......|:|||...|.  ..|:
Zfish    70 GSLINKFWVLTAAHCQIQARSHYVVLGQHDRSS---NDGTVQVKEIAKVITHPDNNIQTLFNNDV 131

  Fly   126 GLIR-TPHVDFNGLINKIPLPSMNEQNDRYQDTWCVACGWGGMDNGNLADWLQCVDVQIISNSEC 189
            .|:: :.......|::.:.|.|.:.:  ....|.||..|||.......|..||...:.|:|.|:|
Zfish   132 TLLKLSSPAQMTSLVSPVCLASSSSK--IVPGTLCVTTGWGRTKTELSARILQEATIPIVSQSQC 194

  Fly   190 EQAYG-SVASTDMCTRHADGKSVCGGDSGGPLVTHDNA--RLVGVITFASVSCH-DGPSGYTRVS 250
            :|.:| |..:..|......|.|.|.|||||||:...:.  ..||::::.:..|. |.|..|.|||
Zfish   195 KQIFGASKITNSMICAGGSGSSSCQGDSGGPLMCESSGVWYQVGIVSWGNRDCRVDFPLVYARVS 259

  Fly   251 DYLEWI 256
            .:.:||
Zfish   260 YFRKWI 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18180NP_648341.1 Tryp_SPc 35..256 CDD:214473 61/199 (31%)
Tryp_SPc 36..259 CDD:238113 63/201 (31%)
si:dkey-238d18.3NP_001373176.1 Tryp_SPc 52..268 CDD:238113 63/201 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.