Sequence 1: | NP_648341.1 | Gene: | CG18180 / 39125 | FlyBaseID: | FBgn0036024 | Length: | 264 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001373176.1 | Gene: | si:dkey-238d18.3 / 795978 | ZFINID: | ZDB-GENE-131127-38 | Length: | 272 | Species: | Danio rerio |
Alignment Length: | 201 | Identity: | 63/201 - (31%) |
---|---|---|---|
Similarity: | 93/201 - (46%) | Gaps: | 17/201 - (8%) |
- Green bases have known domain annotations that are detailed below.
Fly 68 GTIIANDWILTAAHC---LTGDYVEI--HYGSNWGWNGAYRQTVRRDNFISHPDWPSQG--GRDI 125
Fly 126 GLIR-TPHVDFNGLINKIPLPSMNEQNDRYQDTWCVACGWGGMDNGNLADWLQCVDVQIISNSEC 189
Fly 190 EQAYG-SVASTDMCTRHADGKSVCGGDSGGPLVTHDNA--RLVGVITFASVSCH-DGPSGYTRVS 250
Fly 251 DYLEWI 256 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG18180 | NP_648341.1 | Tryp_SPc | 35..256 | CDD:214473 | 61/199 (31%) |
Tryp_SPc | 36..259 | CDD:238113 | 63/201 (31%) | ||
si:dkey-238d18.3 | NP_001373176.1 | Tryp_SPc | 52..268 | CDD:238113 | 63/201 (31%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1522379at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.010 |