DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18180 and ctrb.2

DIOPT Version :9

Sequence 1:NP_648341.1 Gene:CG18180 / 39125 FlyBaseID:FBgn0036024 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001038747.1 Gene:ctrb.2 / 692313 ZFINID:ZDB-GENE-060519-7 Length:263 Species:Danio rerio


Alignment Length:244 Identity:76/244 - (31%)
Similarity:111/244 - (45%) Gaps:35/244 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 RIVNGYPAPEGKAPYIVGLFIRTDGSNSGAVGAGTIIANDWILTAAHC--------LTGDYVEIH 91
            |||||..|.....|:.|.|   .|.:.....| |::|...|::|||||        :.|:    |
Zfish    33 RIVNGEEAVPHSWPWQVSL---QDSTGFHFCG-GSLINEWWVVTAAHCNVRTSHRVILGE----H 89

  Fly    92 YGSNWGWNGAYRQTVRRDNFISHPDWPS-QGGRDIGLIR--TPHVDFNGLINKIPLPSMNEQNDR 153
            ..|:   |....||:.......||::.. ....||.||:  || ...|..::.:.|.   |.||.
Zfish    90 DRSS---NAESIQTMTVGKVFKHPNFNMFTINNDILLIKLATP-AKINTHVSPVCLA---ETNDN 147

  Fly   154 YQDTW-CVACGWGGMDNGNLAD---WLQCVDVQIISNSECEQAYGSVASTDMCTRHADGKSVCGG 214
            :.... ||..|| |:...|..|   .||...:.:::|.:|::.:|:..:..|....|.|.|.|.|
Zfish   148 FPGGMKCVTSGW-GLTKHNAPDTPALLQQAALPLLTNEDCKRFWGNKITDLMVCAGASGASSCMG 211

  Fly   215 DSGGPLVTHDNA--RLVGVITFASVSCH-DGPSGYTRVSDYLEWIRDQT 260
            |||||||...:.  .|||::::.|..|. ..|..|.||:....|: |||
Zfish   212 DSGGPLVCQKDGVWTLVGIVSWGSSVCSPSSPGVYARVTKLRAWV-DQT 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18180NP_648341.1 Tryp_SPc 35..256 CDD:214473 72/238 (30%)
Tryp_SPc 36..259 CDD:238113 72/240 (30%)
ctrb.2NP_001038747.1 Tryp_SPc 33..256 CDD:214473 72/238 (30%)
Tryp_SPc 34..259 CDD:238113 73/241 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.