DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18180 and CG34171

DIOPT Version :9

Sequence 1:NP_648341.1 Gene:CG18180 / 39125 FlyBaseID:FBgn0036024 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001097175.2 Gene:CG34171 / 5740474 FlyBaseID:FBgn0085200 Length:292 Species:Drosophila melanogaster


Alignment Length:310 Identity:70/310 - (22%)
Similarity:107/310 - (34%) Gaps:111/310 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FLLTLSAALALVAASPTGLNRTTLLSQGAEGRIVNGY--PAPEGKAPYIVGL----FIRTDGSNS 62
            :.|.|..||.|..      |.||:.        :|.|  |.....:.|:|.|    :|.|.|.|.
  Fly     5 YFLLLKIALVLPK------NITTIK--------INHYHEPTYSHLSSYLVSLRTRKYIHTPGDNH 55

  Fly    63 GAVGAGTIIANDWILTAAHCLTGD---------------------------YVEIHYGSNWGWNG 100
            ..  .|.|:.|..:||:|||:|..                           .|:||         
  Fly    56 FC--TGVILTNRHVLTSAHCITDKNGVMMSPKRIVVALCASLFKTPESEEFVVDIH--------- 109

  Fly   101 AYRQTVRRDNFISHPDWPSQGGRDIGLIRTP-HVDFNG-------LINKIPLPSMNEQNDRYQDT 157
                     |.|.||.:......||.:|:.. :|..:|       |.|.    |:...||     
  Fly   110 ---------NMIIHPYYHRNQHNDIAIIKLKRYVKLDGHHLAPVVLGNS----SLEVGND----- 156

  Fly   158 WCVACG---------WGGMDNGNLADWLQCVDVQIISNSECEQAYGSVASTD------MCTRHAD 207
             |...|         :|...:      :..|:|::....||.:...|:.:..      :|.:..:
  Fly   157 -CKTIGGIFGVRRQRFGSFHS------MLLVNVELRPFDECLKVKKSLMAARPENEDLICVKSTE 214

  Fly   208 GKSVCGGDSGGPLVTHDNARLVGVITFASVSCHD-GPSGYTRVSDYLEWI 256
             |.:|..|.||||..  :.:|.| |...|::|.. .|..::.||.|..|:
  Fly   215 -KQMCTTDFGGPLFC--DGQLYG-IALGSINCSSPDPVFFSDVSFYNSWV 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18180NP_648341.1 Tryp_SPc 35..256 CDD:214473 61/277 (22%)
Tryp_SPc 36..259 CDD:238113 62/278 (22%)
CG34171NP_001097175.2 Trypsin 29..260 CDD:278516 59/270 (22%)
Tryp_SPc 38..263 CDD:304450 59/263 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471217
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.