DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18180 and cela1.1

DIOPT Version :9

Sequence 1:NP_648341.1 Gene:CG18180 / 39125 FlyBaseID:FBgn0036024 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001020645.2 Gene:cela1.1 / 553249 ZFINID:ZDB-GENE-050522-187 Length:282 Species:Danio rerio


Alignment Length:281 Identity:78/281 - (27%)
Similarity:123/281 - (43%) Gaps:45/281 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLFLLTLSAALALVAASPTGLNRTTLLSQGA-EGRIVNGYPAPEGKAPYIVGLFIRTDGSNSGA 64
            :::.||::.||:        ||.....|...| |.|::.|..|.....|:.:.|..::.|.....
Zfish     2 LRILLLSVLAAI--------GLTEPRYLEDLAIEERVIGGEIAKPHSWPWQISLQYQSGGRYHHY 58

  Fly    65 VGAGTIIANDWILTAAHCLTGDYVEIHYGSNWGWN---GAYRQTVRR--DNFIS------HPDW- 117
            .| ||:|...|::.||||:....:         |:   |.:..|...  :.:||      ||:| 
Zfish    59 CG-GTLIRPGWVMVAAHCVDTSRI---------WSVALGDHDTTTHEGPEQYISVKGVFIHPNWN 113

  Fly   118 PS--QGGRDIGLIR-TPHVDFNGLINKIPLPSMNEQNDRYQDTWCVACGWG-GMDNGNLADWLQC 178
            |:  ..|.||.|:: :.:...:..:....|||..|... |..| |...||| ....|:|:..|:.
Zfish   114 PNIVANGNDIALLQLSINATLSSYVQVATLPSYGEILP-YGHT-CYITGWGRTQTGGSLSAQLKQ 176

  Fly   179 VDVQIISNSECEQA--YGSVASTDM-CTRHADGKSVCGGDSGGPLVTHDNARLV--GVITF-ASV 237
            ..:.::.:..|.|:  :||.....| |.......|.|.||||.||....|...|  ||.:| ||.
Zfish   177 AYMPVVDHETCSQSDWWGSTVKDRMICAGGTTSMSACHGDSGSPLNCLFNGEYVVHGVTSFVASS 241

  Fly   238 SC--HDGPSGYTRVSDYLEWI 256
            .|  :..|:.:||||.::.|:
Zfish   242 GCNTYKKPTVFTRVSYHVSWL 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18180NP_648341.1 Tryp_SPc 35..256 CDD:214473 68/244 (28%)
Tryp_SPc 36..259 CDD:238113 68/245 (28%)
cela1.1NP_001020645.2 Tryp_SPc 29..261 CDD:214473 68/243 (28%)
Tryp_SPc 30..265 CDD:238113 68/245 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.