DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18180 and C1s1

DIOPT Version :9

Sequence 1:NP_648341.1 Gene:CG18180 / 39125 FlyBaseID:FBgn0036024 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001091086.1 Gene:C1s1 / 50908 MGIID:1355312 Length:694 Species:Mus musculus


Alignment Length:250 Identity:60/250 - (24%)
Similarity:90/250 - (36%) Gaps:39/250 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 RIVNGYPAPEGKAPYIVGLFIRTDGSNSGAVGAGTIIANDWILTAAHCLTGDYVEIHYGSNWGWN 99
            ||..|.||.....|:.| .|.....|       |.:|...|:|||||.|......:.|.......
Mouse   443 RIFGGQPAKIENFPWQV-FFNHPRAS-------GALINEYWVLTAAHVLEKISDPLMYVGTMSVR 499

  Fly   100 GAYRQTVRR---DNFISHPDWPSQG--------GRDIGLIRTPH-VDFNGLINKIPLPSMNEQND 152
            ....:..:|   .....||.|..:.        ..||.|::... |.....::.|.||..:.:.:
Mouse   500 TTLLENAQRLYSKRVFIHPSWKKEDDPNTRTNFDNDIALVQLKDPVKMGPKVSPICLPGTSSEYN 564

  Fly   153 RYQDTWCVACGWGGMDNGNLADWLQCVDVQIISNSECEQAYGS---------VASTDMCTRHADG 208
            .......:..|||..:.......|:...|.:.|...|:|....         |.:.:|......|
Mouse   565 VSPGDMGLISGWGSTEKKVFVINLRGAKVPVTSLETCKQVKEENPTVRPEDYVFTDNMICAGEKG 629

  Fly   209 KSVCGGDSGG------PLVTHDNARLVGVITFASVSCHDGPSG-YTRVSDYLEWI 256
            ...|.|||||      |.||.....:.|::::.. .|  |..| ||:|.:|::||
Mouse   630 VDSCHGDSGGAFAFQVPNVTVPKFYVAGLVSWGK-RC--GTYGVYTKVKNYVDWI 681

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18180NP_648341.1 Tryp_SPc 35..256 CDD:214473 58/248 (23%)
Tryp_SPc 36..259 CDD:238113 58/248 (23%)
C1s1NP_001091086.1 CUB 24..135 CDD:238001
FXa_inhibition 149..177 CDD:373209
CUB 181..293 CDD:366096
CCP 307..361 CDD:153056
CCP 365..428 CDD:153056
Tryp_SPc 443..681 CDD:214473 58/248 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.