DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18180 and CTRB2

DIOPT Version :9

Sequence 1:NP_648341.1 Gene:CG18180 / 39125 FlyBaseID:FBgn0036024 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001020371.3 Gene:CTRB2 / 440387 HGNCID:2522 Length:263 Species:Homo sapiens


Alignment Length:236 Identity:79/236 - (33%)
Similarity:118/236 - (50%) Gaps:24/236 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 RIVNGYPAPEGKAPYIVGLFIRTDGSNSGAVGAGTIIANDWILTAAHC--LTGDYV---EIHYGS 94
            |||||..|..|..|:.|.|..:|.....|    |::|:.||::|||||  .|.|.|   |...||
Human    33 RIVNGEDAVPGSWPWQVSLQDKTGFHFCG----GSLISEDWVVTAAHCGVRTSDVVVAGEFDQGS 93

  Fly    95 NWGWNGAYRQTVRRDNFISHPDWP-SQGGRDIGLIR--TPHVDFNGLINKIPLPSMNEQNDRYQD 156
                :....|.::......:|.:. .....||.|::  || ..|:..::.:.|||.::  |....
Human    94 ----DEENIQVLKIAKVFKNPKFSILTVNNDITLLKLATP-ARFSQTVSAVCLPSADD--DFPAG 151

  Fly   157 TWCVACGWGGMD-NGN-LADWLQCVDVQIISNSECEQAYGSVASTDMCTRHADGKSVCGGDSGGP 219
            |.|...|||... |.| ..|.||...:.::||:||::::|...:..|....|.|.|.|.||||||
Human   152 TLCATTGWGKTKYNANKTPDKLQQAALPLLSNAECKKSWGRRITDVMICAGASGVSSCMGDSGGP 216

  Fly   220 LVTH-DNA-RLVGVITFASVSCH-DGPSGYTRVSDYLEWIR 257
            ||.. |.| .|||::::.|.:|. ..|:.|.||:..:.|::
Human   217 LVCQKDGAWTLVGIVSWGSRTCSTTTPAVYARVAKLIPWVQ 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18180NP_648341.1 Tryp_SPc 35..256 CDD:214473 78/233 (33%)
Tryp_SPc 36..259 CDD:238113 78/235 (33%)
CTRB2NP_001020371.3 Tryp_SPc 33..256 CDD:214473 78/233 (33%)
Tryp_SPc 34..259 CDD:238113 78/235 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.