DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18180 and CG9737

DIOPT Version :9

Sequence 1:NP_648341.1 Gene:CG18180 / 39125 FlyBaseID:FBgn0036024 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_651783.1 Gene:CG9737 / 43600 FlyBaseID:FBgn0039758 Length:424 Species:Drosophila melanogaster


Alignment Length:278 Identity:71/278 - (25%)
Similarity:112/278 - (40%) Gaps:46/278 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 TGLNRTTLLSQGAEGRIVNGYPAPEGKAPYIVGLFIRTDGSNSGAVG-AGTIIANDWILTAAHCL 83
            :|.|......:....||..|..|...:.|::..|..     ||...| :|.:|.:..|||||||:
  Fly   134 SGFNLLNECGKQVTNRIYGGEIAELDEFPWLALLVY-----NSNDYGCSGALIDDRHILTAAHCV 193

  Fly    84 TGDYVEIHYGSNWGWNGAYR-----QTVRRDNFIS---------------HPDWPSQGG---RDI 125
            .|:.|....|......|.:.     ..:...|::|               ||::.....   .||
  Fly   194 QGEGVRDRQGLKHVRLGEFNVKTEPDCIEEPNYLSCADAALDIAYEKIHVHPEYKEFSNYKYNDI 258

  Fly   126 GLIRTPH-VDFNGLINKIPLPSMNEQNDRYQDTWCVACGWGGMD--NGNLADWLQCVDVQI---- 183
            .:||..| |.|...:..|.||:.:|.....:.......|||..|  |....:....:.:::    
  Fly   259 AIIRLKHPVSFTHFVMPICLPNKSEPLTLAEGQMFSVSGWGRTDLFNKYFINIHSPIKLKLRIPY 323

  Fly   184 ISNSECE---QAYG-SVASTDMCTRHADGKSVCGGDSGGPLVTHD--NARLV--GVITFASVSC- 239
            :||..|.   :.:| .:....:|......|..|.|||||||:..|  ::|.|  ||:::....| 
  Fly   324 VSNENCTKILEGFGVRLGPKQICAGGEFAKDTCAGDSGGPLMYFDRQHSRWVAYGVVSYGFTQCG 388

  Fly   240 -HDGPSGYTRVSDYLEWI 256
             ...|:.||.|::|.:||
  Fly   389 MAGKPAVYTNVAEYTDWI 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18180NP_648341.1 Tryp_SPc 35..256 CDD:214473 67/261 (26%)
Tryp_SPc 36..259 CDD:238113 68/262 (26%)
CG9737NP_651783.1 CLIP 28..89 CDD:288855
Tryp_SPc 149..406 CDD:214473 67/261 (26%)
Tryp_SPc 150..409 CDD:238113 68/262 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.