DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18180 and Jon99Ci

DIOPT Version :9

Sequence 1:NP_648341.1 Gene:CG18180 / 39125 FlyBaseID:FBgn0036024 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_524555.1 Gene:Jon99Ci / 43545 FlyBaseID:FBgn0003358 Length:272 Species:Drosophila melanogaster


Alignment Length:241 Identity:108/241 - (44%)
Similarity:160/241 - (66%) Gaps:11/241 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 GAEGRIVNGYPAPEGKAPYIVGLFIRTDGSNSGAVGAGTIIANDWILTAAHCLTG-DYVEIHYGS 94
            |.||||.||..|.||:.|||||:.:.::| |....| |:||.:.|:||||||..| |...::||:
  Fly    36 GIEGRITNGNLASEGQVPYIVGVSLNSNG-NWWWCG-GSIIGHTWVLTAAHCTAGADEASLYYGA 98

  Fly    95 -NWGWNGAYRQTVRRDNFISHPDWPSQGGRDIGLIRTPHVDFNGLINKIPLPSMNEQNDRYQDTW 158
             |:. ..|:|.||..:|||.:|.:... ..|:.||:||||||..|:|||.|||::::.:.|::.|
  Fly    99 VNYN-EPAFRHTVSSENFIRYPHYVGL-DHDLALIKTPHVDFYSLVNKIELPSLDDRYNSYENNW 161

  Fly   159 CVACGWGGM-DNGNLADWLQCVDVQIISNSECEQAYGSVASTD--MCTRHADGKSVCGGDSGGPL 220
            ..|.|||.: |..|:.:.|:.||:::||.:||:..||:..:::  :|....|||:.|.|||||||
  Fly   162 VQAAGWGAIYDGSNVVEDLRVVDLKVISVAECQAYYGTDTASENTICVETPDGKATCQGDSGGPL 226

  Fly   221 VTHDNARLVGVITFASV-SCH-DGPSGYTRVSDYLEWIRDQTGISY 264
            ||.:..:|:|:.:|.|. .|. .||:|:|||:.|||||:::|||.|
  Fly   227 VTKEGDKLIGITSFVSAYGCQVGGPAGFTRVTKYLEWIKEETGIYY 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18180NP_648341.1 Tryp_SPc 35..256 CDD:214473 99/227 (44%)
Tryp_SPc 36..259 CDD:238113 100/229 (44%)
Jon99CiNP_524555.1 Tryp_SPc 40..264 CDD:214473 99/227 (44%)
Tryp_SPc 41..266 CDD:238113 100/228 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470811
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H134616
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.950

Return to query results.
Submit another query.