DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18180 and CG11842

DIOPT Version :9

Sequence 1:NP_648341.1 Gene:CG18180 / 39125 FlyBaseID:FBgn0036024 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_651662.1 Gene:CG11842 / 43431 FlyBaseID:FBgn0039629 Length:319 Species:Drosophila melanogaster


Alignment Length:257 Identity:71/257 - (27%)
Similarity:107/257 - (41%) Gaps:47/257 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 IVNGYPAPEGKAPYIVGLFIRTDGSNSGAVGAGTIIANDWILTAAHCLTGDYVEIHYGSNWGWNG 100
            |:.|.||...:.|:...|..:.:.........||:|::..:||||||        ||......|.
  Fly    73 IIGGGPAVPKEFPHAARLGHKDENGEVEWFCGGTLISDRHVLTAAHC--------HYSPQGSVNI 129

  Fly   101 AYRQTVRRD--------------NFISHPDWPSQG-GRDIGLIRTPH-VDFNGLINKIPLPSMNE 149
            |....:..|              :|.:||::.... ..||.::|... |.||...:...||.   
  Fly   130 ARLGDLEFDTNNDDADPEDFDVKDFTAHPEFSYPAIYNDISVVRLSRPVTFNDYKHPACLPF--- 191

  Fly   150 QNDRYQDTWCVACGWGGMDNGNLADWLQCVDVQIIS-----------NSECEQAYGSVASTDMCT 203
             :|....|..:|.|||.::.....:..:...|::.:           |.|..:.|.  |:|.:|.
  Fly   192 -DDGRLGTSFIAIGWGQLEIVPRTENKKLQKVKLYNYGTRCRITADRNDELPEGYN--ATTQLCI 253

  Fly   204 RHADGKSVCGGDSGGP-LVTH-DNARLVGV--ITFASVSCH--DGPSGYTRVSDYLEWIRDQ 259
            ...:.|..|.|||||| |:.| |...:..|  ||...|:|.  |.|:.||||..||:||:.|
  Fly   254 GSNEHKDTCNGDSGGPVLIYHMDYPCMYHVMGITSIGVACDTPDLPAMYTRVHFYLDWIKQQ 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18180NP_648341.1 Tryp_SPc 35..256 CDD:214473 68/252 (27%)
Tryp_SPc 36..259 CDD:238113 70/255 (27%)
CG11842NP_651662.1 Tryp_SPc 73..315 CDD:238113 70/255 (27%)
Tryp_SPc 73..312 CDD:214473 68/252 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437116
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.