DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18180 and CG11841

DIOPT Version :9

Sequence 1:NP_648341.1 Gene:CG18180 / 39125 FlyBaseID:FBgn0036024 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_651661.1 Gene:CG11841 / 43430 FlyBaseID:FBgn0039628 Length:319 Species:Drosophila melanogaster


Alignment Length:268 Identity:75/268 - (27%)
Similarity:113/268 - (42%) Gaps:60/268 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 GAEGRIVNGYPAPEGKAPYIVGLFIRTDGSNSGAVGAGTIIANDWILTAAHCLTGDYVEIHYGSN 95
            |:...||:|.||...:.|:...|..|...:.......||:|:|..:||||||...::.|::    
  Fly    67 GSRPLIVDGTPAEPKEFPFAARLGHRKTNNEIKWFCGGTLISNRLVLTAAHCFFSEHGEVN---- 127

  Fly    96 WGWNGAYRQTVR--------------RDNF-----ISHPDWPS-QGGRDIGLIRTP-HVDFNGLI 139
                     .||              .::|     .:||.:.: |...|||:::.. .|.||...
  Fly   128 ---------VVRLGELEFDTDTDDAEPEDFGVLALKAHPGFENPQLYNDIGIVQLDREVKFNRYK 183

  Fly   140 NKIPLP-SMNEQNDRYQDTWCVACGWGGMDNGN------LADWLQ-----CVDVQIISNSECEQA 192
            :...|| ...||::.:     :|.|||......      |...||     ||. .:.:|.|....
  Fly   184 HPACLPFDDGEQHESF-----IAIGWGQKKFAQKESKKLLKVQLQGYKDRCVS-SVDANDELPNG 242

  Fly   193 YGSVASTDMCTRHADGKSVCGGDSGGPLVTH--DNARLVGV--ITFASVSCH--DGPSGYTRVSD 251
            |  ...:.:|....|.|..|.||||||::.:  |.|.:..|  ||.|.::|.  |.||.||||..
  Fly   243 Y--EPKSQLCIGSRDNKDTCNGDSGGPVLAYHKDLACMYHVMGITSAGITCSTPDIPSAYTRVHY 305

  Fly   252 YLEWIRDQ 259
            :|.||:.:
  Fly   306 FLNWIKGE 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18180NP_648341.1 Tryp_SPc 35..256 CDD:214473 72/259 (28%)
Tryp_SPc 36..259 CDD:238113 74/261 (28%)
CG11841NP_651661.1 Tryp_SPc 72..311 CDD:238113 73/259 (28%)
Tryp_SPc 72..310 CDD:214473 72/258 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437117
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.